2025-03-13 00:45:30, GGRNA.v2 : RefSeq release 228 (Jan, 2025)
LOCUS NM_001252260 1401 bp mRNA linear ROD 24-DEC-2024 DEFINITION Mus musculus nucleophosmin 1 (Npm1), transcript variant 2, mRNA. ACCESSION NM_001252260 VERSION NM_001252260.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 1401) AUTHORS Bowman,R.L., Dunbar,A.J., Mishra,T., Xiao,W., Waarts,M.R., Maestre,I.F., Eisman,S.E., Cai,L., Mowla,S., Shah,N., Youn,A., Bennett,L., Fontenard,S., Gounder,S., Gandhi,A., Bowman,M., O'Connor,K., Zaroogian,Z., Sanchez-Vela,P., Martinez Benitez,A.R., Werewski,M., Park,Y., Csete,I.S., Krishnan,A., Lee,D., Boorady,N., Potts,C.R., Jenkins,M.T., Cai,S.F., Carroll,M.P., Meyer,S.E., Miles,L.A., Ferrell,P.B. Jr., Trowbridge,J.J. and Levine,R.L. TITLE In vivo models of subclonal oncogenesis and dependency in hematopoietic malignancy JOURNAL Cancer Cell 42 (11), 1955-1969 (2024) PUBMED 39532065 REFERENCE 2 (bases 1 to 1401) AUTHORS Zhang,S., Zhang,Y., Duan,X., Wang,B. and Zhan,Z. TITLE Targeting NPM1 Epigenetically Promotes Postinfarction Cardiac Repair by Reprogramming Reparative Macrophage Metabolism JOURNAL Circulation 149 (25), 1982-2001 (2024) PUBMED 38390737 REMARK GeneRIF: Targeting NPM1 Epigenetically Promotes Postinfarction Cardiac Repair by Reprogramming Reparative Macrophage Metabolism. REFERENCE 3 (bases 1 to 1401) AUTHORS Korai,A., Lin,X., Tago,K. and Funakoshi-Tago,M. TITLE The acetylation of STAT3 at K685 attenuates NPM-ALK-induced tumorigenesis JOURNAL Cell Signal 114, 110985 (2024) PUBMED 38000524 REMARK GeneRIF: The acetylation of STAT3 at K685 attenuates NPM-ALK-induced tumorigenesis. REFERENCE 4 (bases 1 to 1401) AUTHORS Fang,Y., Zhang,J., Zhu,D., Mei,Q., Liao,T., Cheng,H., He,Y., Cao,Y. and Wei,Z. TITLE MANF Promotes Unexplained Recurrent Miscarriages by Interacting with NPM1 and Downregulating Trophoblast Cell Migration and Invasion JOURNAL Int J Biol Sci 20 (1), 296-311 (2024) PUBMED 38164189 REMARK GeneRIF: MANF Promotes Unexplained Recurrent Miscarriages by Interacting with NPM1 and Downregulating Trophoblast Cell Migration and Invasion. Publication Status: Online-Only REFERENCE 5 (bases 1 to 1401) AUTHORS Izzo,A., Akol,I., Villarreal,A., Lebel,S., Garcia-Miralles,M., Cheffer,A., Bovio,P., Heidrich,S. and Vogel,T. TITLE Nucleophosmin 1 cooperates with the methyltransferase DOT1L to preserve peri-nucleolar heterochromatin organization by regulating H3K27me3 levels and DNA repeats expression JOURNAL Epigenetics Chromatin 16 (1), 36 (2023) PUBMED 37759327 REMARK GeneRIF: Nucleophosmin 1 cooperates with the methyltransferase DOT1L to preserve peri-nucleolar heterochromatin organization by regulating H3K27me3 levels and DNA repeats expression. Publication Status: Online-Only REFERENCE 6 (bases 1 to 1401) AUTHORS Sowden,J.C., Morrison,K., Putt,W., Beddington,R. and Edwards,Y.H. TITLE The identification of novel sequences expressed in the mouse notochord JOURNAL Mamm Genome 8 (1), 42-44 (1997) PUBMED 9021147 REFERENCE 7 (bases 1 to 1401) AUTHORS Inouye,C.J. and Seto,E. TITLE Relief of YY1-induced transcriptional repression by protein-protein interaction with the nucleolar phosphoprotein B23 JOURNAL J Biol Chem 269 (9), 6506-6510 (1994) PUBMED 8120001 REFERENCE 8 (bases 1 to 1401) AUTHORS Van den Eynde,B., Lethe,B., Van Pel,A., De Plaen,E. and Boon,T. TITLE The gene coding for a major tumor rejection antigen of tumor P815 is identical to the normal gene of syngeneic DBA/2 mice JOURNAL J Exp Med 173 (6), 1373-1384 (1991) PUBMED 1903428 REFERENCE 9 (bases 1 to 1401) AUTHORS Biggiogera,M., Burki,K., Kaufmann,S.H., Shaper,J.H., Gas,N., Amalric,F. and Fakan,S. TITLE Nucleolar distribution of proteins B23 and nucleolin in mouse preimplantation embryos as visualized by immunoelectron microscopy JOURNAL Development 110 (4), 1263-1270 (1990) PUBMED 2100262 REFERENCE 10 (bases 1 to 1401) AUTHORS Schmidt-Zachmann,M.S. and Franke,W.W. TITLE DNA cloning and amino acid sequence determination of a major constituent protein of mammalian nucleoli. Correspondence of the nucleoplasmin-related protein NO38 to mammalian protein B23 JOURNAL Chromosoma 96 (6), 417-426 (1988) PUBMED 3219912 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from CA540276.1, BU513690.1, BC089546.1 and CX567338.1. Transcript Variant: This variant (2) lacks an in-frame segment in the 5' coding region, compared to variant 1. The resulting isoform (2) lacks an internal segment, compared to isoform 1. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: SRR17784646.1017816.1 [ECO:0000332] RNAseq introns :: mixed sample support SAMN00849374, SAMN00849375 [ECO:0006172] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-144 CA540276.1 1-144 145-622 BU513690.1 1-478 623-748 BU513690.1 480-605 749-1307 BC089546.1 658-1216 1308-1401 CX567338.1 632-725 FEATURES Location/Qualifiers source 1..1401 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="11" /map="11 19.21 cM" gene 1..1401 /gene="Npm1" /gene_synonym="B23; NO38; Npm" /note="nucleophosmin 1" /db_xref="GeneID:18148" /db_xref="MGI:MGI:106184" exon 1..285 /gene="Npm1" /gene_synonym="B23; NO38; Npm" /inference="alignment:Splign:2.1.0" CDS 228..1067 /gene="Npm1" /gene_synonym="B23; NO38; Npm" /note="isoform 2 is encoded by transcript variant 2; numatrin; nucleolar phosphoprotein B23; nucleolar protein NO38" /codon_start=1 /product="nucleophosmin isoform 2" /protein_id="NP_001239189.1" /db_xref="GeneID:18148" /db_xref="MGI:MGI:106184" /translation="
MEDSMDMDMSPLRPQNYLFVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDEDDDEDDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL"
misc_feature 288..539 /gene="Npm1" /gene_synonym="B23; NO38; Npm" /note="Nucleoplasmin/nucleophosmin domain; Region: Nucleoplasmin; pfam03066" /db_xref="CDD:460792" misc_feature 915..1061 /gene="Npm1" /gene_synonym="B23; NO38; Npm" /note="Nucleophosmin C-terminal domain; Region: NPM1-C; pfam16276" /db_xref="CDD:465081" exon 286..326 /gene="Npm1" /gene_synonym="B23; NO38; Npm" /inference="alignment:Splign:2.1.0" exon 327..446 /gene="Npm1" /gene_synonym="B23; NO38; Npm" /inference="alignment:Splign:2.1.0" exon 447..540 /gene="Npm1" /gene_synonym="B23; NO38; Npm" /inference="alignment:Splign:2.1.0" exon 541..647 /gene="Npm1" /gene_synonym="B23; NO38; Npm" /inference="alignment:Splign:2.1.0" exon 648..709 /gene="Npm1" /gene_synonym="B23; NO38; Npm" /inference="alignment:Splign:2.1.0" exon 710..767 /gene="Npm1" /gene_synonym="B23; NO38; Npm" /inference="alignment:Splign:2.1.0" exon 768..851 /gene="Npm1" /gene_synonym="B23; NO38; Npm" /inference="alignment:Splign:2.1.0" exon 852..953 /gene="Npm1" /gene_synonym="B23; NO38; Npm" /inference="alignment:Splign:2.1.0" exon 954..1028 /gene="Npm1" /gene_synonym="B23; NO38; Npm" /inference="alignment:Splign:2.1.0" exon 1029..1383 /gene="Npm1" /gene_synonym="B23; NO38; Npm" /inference="alignment:Splign:2.1.0" ORIGIN
ggcgcacgcgcaaaagcgcgactgtgcggggagtgggagggatccagaggaggctcgcggaggcaggactagcgcagatctcgcgagatctcctgcgaccatatatacgtgcggagagcccgcgtcctttccttggcgtgattccgtcctgcgcgtctgttctgtggaacaggaggcagttgttttccgtccggcttctcccacaccgaagtgcgcgcctccacctcatggaagactcgatggatatggacatgagtcctcttaggcctcagaactaccttttcgtggataatgatgaaaatgagcaccagttgtcattaagaacggtcagtttaggagcaggggcaaaagatgagttacacatcgtagaggcagaagcaatgaactatgaaggcagtccaattaaagtaacactggcaactttgaaaatgtctgtacaaccaacagtttccctagggggctttgaaattacaccacctgtggtcttacggttgaagtgtggttcagggcctgtgcacattagtggacagcatctagtagctgtagaggaagatgcagagtctgaagatgaagatgaggaggacgtaaaactcttaggcatgtctggaaagcgatctgctcctggaggtggtaacaaggttccacagaaaaaagtaaaacttgatgaagatgatgaggacgatgatgaggacgatgaggatgatgaggatgatgatgatgatgattttgatgaagaggaaactgaagaaaaggtcccagtgaagaaatctgtacgagataccccagccaaaaatgcacaaaaatcaaaccaaaatggaaaagacttaaaaccatcaacaccgagatcaaagggtcaagagtccttcaaaaaacaggaaaagactcctaaaacaccaaaaggacctagttctgtagaagacattaaggcaaaaatgcaagcaagtatagaaaaaggcggttctcttcccaaagtggaagccaagttcattaattatgtgaagaattgtttccggatgactgaccaggaggctattcaagatctctggcagtggaggaaatctctttaagaaaagggtttaaacagtttgaaatattctgtcttcatttctgtaatagttaatatctggctgtcctttttataatgcaaagtgagaactttccctactgtgtttgataaatgttgtccaggttcacttgccaagaatgtgttgtctaaaatgcctgtttagttttcaaggatggaactccaccctttacttggttttaagtatgtatggaatgttatgataggacatagtaatagtggtcagatgtggaaatggtagggagacaaatatacatgtgaaataaactcagtattttaataaagtagcactgtttctaaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]