2024-09-28 11:19:18, GGRNA.v2 : RefSeq release 225 (Jul, 2024)
LOCUS NM_001197041 1306 bp mRNA linear ROD 03-APR-2024 DEFINITION Mus musculus coiled-coil domain containing 7A (Ccdc7a), transcript variant 2, mRNA. ACCESSION NM_001197041 VERSION NM_001197041.1 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 1306) AUTHORS Satoh,A., Brace,C.S., Rensing,N. and Imai,S. TITLE Deficiency of Prdm13, a dorsomedial hypothalamus-enriched gene, mimics age-associated changes in sleep quality and adiposity JOURNAL Aging Cell 14 (2), 209-218 (2015) PUBMED 25546159 REFERENCE 2 (bases 1 to 1306) AUTHORS Zhou,C., Zhang,P., Xu,G.C., Wu,D.M., Liu,R.Y., Zeng,Q. and Wang,C.T. TITLE RNA interference of Biot2 induces G1 phase arrest and apoptosis in mouse colorectal cancer cell line JOURNAL Oncol Res 22 (2), 93-103 (2015) PUBMED 25706396 REMARK GeneRIF: silencing Biot2 in CT26 cells by RNA interference can inhibit cell growth in vitro and in vivo. REFERENCE 3 (bases 1 to 1306) AUTHORS Satoh,A., Brace,C.S., Rensing,N., Cliften,P., Wozniak,D.F., Herzog,E.D., Yamada,K.A. and Imai,S. TITLE Sirt1 extends life span and delays aging in mice through the regulation of Nk2 homeobox 1 in the DMH and LH JOURNAL Cell Metab 18 (3), 416-430 (2013) PUBMED 24011076 REFERENCE 4 (bases 1 to 1306) AUTHORS Satoh,A., Brace,C.S., Ben-Josef,G., West,T., Wozniak,D.F., Holtzman,D.M., Herzog,E.D. and Imai,S. TITLE SIRT1 promotes the central adaptive response to diet restriction through activation of the dorsomedial and lateral nuclei of the hypothalamus JOURNAL J Neurosci 30 (30), 10220-10232 (2010) PUBMED 20668205 REFERENCE 5 (bases 1 to 1306) AUTHORS Wang,H., Zhang,P. and Wang,C.T. TITLE [Analysis of expression pattern of a novel testis-highly expressed gene Biot2-L and the primary study on its role in testis development] JOURNAL Sichuan Da Xue Xue Bao Yi Xue Ban 40 (5), 853-856 (2009) PUBMED 19950598 REMARK GeneRIF: Biot2-L was highly expressed in adult testis, and its expression increased regularly during testis development. REFERENCE 6 (bases 1 to 1306) AUTHORS Wang,C.T., Zhang,P., Wang,Y.S., Ruan,X.Z., Li,Z.Y., Peng,F., Yang,H.S. and Wei,Y.Q. TITLE RNA interference against Biot2, a novel mouse testis-specific gene, inhibits the growth of tumor cells JOURNAL Cell Mol Biol Lett 14 (3), 363-376 (2009) PUBMED 19277478 REMARK GeneRIF: The Biot2 transcript was detected only and strongly in the testis tissues and abundantly in five types of murine cancer cell line. COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AK016006.1 and AK015811.1. Transcript Variant: This variant (2) differs in the 3' UTR and coding sequence compared to variant 1. The resulting isoform (2) has a shorter and distinct C-terminus compared to isoform 1. ##Evidence-Data-START## Transcript exon combination :: AK016006.1, EF100607.1 [ECO:0000332] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-431 AK016006.1 1-431 432-619 AK015811.1 414-601 620-1306 AK016006.1 620-1306 FEATURES Location/Qualifiers source 1..1306 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="8" /map="8 76.12 cM" gene 1..1306 /gene="Ccdc7a" /gene_synonym="100042659; 4930517G15Rik; 4930540C21Rik; Biot2; Ccdc7; Gm3952" /note="coiled-coil domain containing 7A" /db_xref="GeneID:74703" /db_xref="MGI:MGI:1921953" exon 1..225 /gene="Ccdc7a" /gene_synonym="100042659; 4930517G15Rik; 4930540C21Rik; Biot2; Ccdc7; Gm3952" /inference="alignment:Splign:2.1.0" exon 226..343 /gene="Ccdc7a" /gene_synonym="100042659; 4930517G15Rik; 4930540C21Rik; Biot2; Ccdc7; Gm3952" /inference="alignment:Splign:2.1.0" misc_feature 305..307 /gene="Ccdc7a" /gene_synonym="100042659; 4930517G15Rik; 4930540C21Rik; Biot2; Ccdc7; Gm3952" /note="upstream in-frame stop codon" exon 344..667 /gene="Ccdc7a" /gene_synonym="100042659; 4930517G15Rik; 4930540C21Rik; Biot2; Ccdc7; Gm3952" /inference="alignment:Splign:2.1.0" CDS 395..877 /gene="Ccdc7a" /gene_synonym="100042659; 4930517G15Rik; 4930540C21Rik; Biot2; Ccdc7; Gm3952" /note="isoform 2 is encoded by transcript variant 2; testis-specific antigen; putative cancer/testis antigen; coiled-coil domain-containing protein 7; coiled-coil domain containing 7" /codon_start=1 /product="coiled-coil domain-containing protein 7 isoform 2" /protein_id="NP_001183970.1" /db_xref="CCDS:CCDS57649.1" /db_xref="GeneID:74703" /db_xref="MGI:MGI:1921953" /translation="
MKCAKHPSTISMKLTSVPELPYKKGLLNSSPKPKEKHNAKSKYGKNESMVLRSPPTGESIVRFALPIPLSKTKDKISADEMVRRITTNLKMVVSNLEDTYGACYDNGEKAAEKSEAEGLSIGDDVSSFLLCCSQFTSQLEEAVKEECGKKTFQNYCQNFQ"
misc_feature 395..838 /gene="Ccdc7a" /gene_synonym="100042659; 4930517G15Rik; 4930540C21Rik; Biot2; Ccdc7; Gm3952" /note="Spermatogenesis family BioT2; Region: BioT2; pfam15368" /db_xref="CDD:464678" misc_feature 455..547 /gene="Ccdc7a" /gene_synonym="100042659; 4930517G15Rik; 4930540C21Rik; Biot2; Ccdc7; Gm3952" /note="propagated from UniProtKB/Swiss-Prot (Q9D541.1); Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite" exon 668..754 /gene="Ccdc7a" /gene_synonym="100042659; 4930517G15Rik; 4930540C21Rik; Biot2; Ccdc7; Gm3952" /inference="alignment:Splign:2.1.0" exon 755..838 /gene="Ccdc7a" /gene_synonym="100042659; 4930517G15Rik; 4930540C21Rik; Biot2; Ccdc7; Gm3952" /inference="alignment:Splign:2.1.0" exon 839..1306 /gene="Ccdc7a" /gene_synonym="100042659; 4930517G15Rik; 4930540C21Rik; Biot2; Ccdc7; Gm3952" /inference="alignment:Splign:2.1.0" ORIGIN
ggtcggttgttaccaccctgggcgcaaaggcccccctttccctttcagcacagatgtcagtttgtactggggcagagctgttgtctggagagtttgctggcatcttccaaagaggtgtaggaaacgcggaatttacaactttctcagacaaatagattctcaccttccagcctgccaccccaaagccaagccacccagtaagaccacttccaacagcctcagcagcattccgatcctccttgagagcaaatgatattcacatcaggtcatcatgtatacaattcaggacttaccttcagaatgatgaaagcacagagaggataacagatcctgcagcacaactggaggtactgaatttttcataagtaatttggaagctaaatcaatcacaaaaatgaaatgtgcaaagcatccatcaaccattagtatgaaattgacaagtgttccagaattaccttataagaaaggcttactgaattcatcacctaagccaaaagaaaaacataatgccaagtcaaagtatggtaaaaatgaatcaatggtcctgaggtcgccacccacaggagagtcaattgtacgctttgccttgccaataccattgagtaaaacgaaggacaaaatatcagctgatgaaatggtcaggaggattaccacaaatctgaagatggttgtttctaacttggaagacacctatggagcttgctatgataatggagaaaaagcagcagaaaaaagtgaagcagaaggcttgtctattggtgatgatgtgagttcgttcttgttgtgctgttcacaatttacatctcagctggaagaagcagttaaggaagaatgtggcaaaaaaacatttcaaaactattgccaaaattttcagtaatccaaacaatattttaccatatgaagatggagctatagacctgtaaaatgagtagagaacccagaagtgaagagagggcttcattggtgacctgcctacctgttgcataaggatgaggatctgaggtagatcccgaacatctatataaaatctggttggtgctcatctaaaaccattatattgggatgagggatggagatggagatggagatggagatggagatggagatggagatggagatggagatggagaaggagatggagaatgagatggagatggagatggagatagatggatggatccatggagcttgatggtcacccaatctggccaattggtaagcttcaggttcatcaaaatagaaatcataatgagaaggaaatataagccacaatagaaatgcctaaataaatcaactatattaaaat
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]