GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-09-18 11:53:54, GGRNA.v2 : RefSeq release 231 (Jul, 2025)

LOCUS       NM_001100465             779 bp    mRNA    linear   ROD 07-AUG-2023
DEFINITION  Mus musculus reproductive homeobox 2H (Rhox2h), mRNA.
ACCESSION   NM_001100465 XM_886726
VERSION     NM_001100465.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 779)
  AUTHORS   MacLean,J.A. 2nd, Lorenzetti,D., Hu,Z., Salerno,W.J., Miller,J. and
            Wilkinson,M.F.
  TITLE     Rhox homeobox gene cluster: recent duplication of three family
            members
  JOURNAL   Genesis 44 (3), 122-129 (2006)
   PUBMED   16496311
REFERENCE   2  (bases 1 to 779)
  AUTHORS   Morris L, Gordon J and Blackburn CC.
  TITLE     Identification of a tandem duplicated array in the Rhox alpha locus
            on mouse chromosome X
  JOURNAL   Mamm Genome 17 (2), 178-187 (2006)
   PUBMED   16465597
REFERENCE   3  (bases 1 to 779)
  AUTHORS   Maclean JA 2nd, Chen MA, Wayne CM, Bruce SR, Rao M, Meistrich ML,
            Macleod C and Wilkinson MF.
  TITLE     Rhox: a new homeobox gene cluster
  JOURNAL   Cell 120 (3), 369-382 (2005)
   PUBMED   15707895
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AL808133.17.
            
            On Aug 4, 2007 this sequence version replaced XM_886726.3.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            ##Evidence-Data-START##
            RNAseq introns :: single sample supports all introns SAMN00849384,
                              SAMN01164134 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            inferred exon combination :: based on alignments, homology
            RefSeq Select criteria    :: based on single protein-coding
                                         transcript
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-95                AL808133.17        152981-153075       c
            96-507              AL808133.17        152407-152818       c
            508-553             AL808133.17        150818-150863       c
            554-779             AL808133.17        148795-149020       c
FEATURES             Location/Qualifiers
     source          1..779
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="X"
                     /map="X 21.98 cM"
     gene            1..779
                     /gene="Rhox2h"
                     /gene_synonym="Rhox2.8; Rhox2g"
                     /note="reproductive homeobox 2H"
                     /db_xref="GeneID:622301"
                     /db_xref="MGI:MGI:3713490"
     exon            1..95
                     /gene="Rhox2h"
                     /gene_synonym="Rhox2.8; Rhox2g"
                     /inference="alignment:Splign:2.1.0"
     CDS             29..604
                     /gene="Rhox2h"
                     /gene_synonym="Rhox2.8; Rhox2g"
                     /note="reproductive homeobox 2G"
                     /codon_start=1
                     /product="reproductive homeobox 2H"
                     /protein_id="NP_001093935.1"
                     /db_xref="CCDS:CCDS40942.1"
                     /db_xref="GeneID:622301"
                     /db_xref="MGI:MGI:3713490"
                     /translation="
MEKRSINYLLDVGPEEDEENANGVKTLMVLLAGEGRNEGESGRGLPGSGVSAAEGYRAGELSAGGPAAPVAGLMDNSNQEDLSATGCAQEKETQPEEPVPDSMGDLENVKPMSGPWSTVNPVRVLVPKFRHLWRHNFNVLQLQELESIFQCNHYISTTEENRLARSMGVSEATVQEWFLKRREKYRSYKRL"
     misc_feature    428..586
                     /gene="Rhox2h"
                     /gene_synonym="Rhox2.8; Rhox2g"
                     /note="Homeodomain; DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:238039"
     misc_feature    order(434..436,554..556,563..568,575..577)
                     /gene="Rhox2h"
                     /gene_synonym="Rhox2.8; Rhox2g"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            96..507
                     /gene="Rhox2h"
                     /gene_synonym="Rhox2.8; Rhox2g"
                     /inference="alignment:Splign:2.1.0"
     exon            508..553
                     /gene="Rhox2h"
                     /gene_synonym="Rhox2.8; Rhox2g"
                     /inference="alignment:Splign:2.1.0"
     exon            554..779
                     /gene="Rhox2h"
                     /gene_synonym="Rhox2.8; Rhox2g"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
gaataacgacttccacggctttacagacatggagaaaagaagcatcaattacctgcttgatgtgggacctgaggaggatgaggaaaatgcgaatggtgtaaagactctgatggtcttgctggctggagagggaagaaacgagggagagagtggacggggcctgcctgggtcgggagtctcagcagcggaaggatacagagcaggagaattaagtgcaggtgggccggctgcgcctgtagcaggcctcatggataacagcaaccaagaggaccttagtgccactggctgtgcccaggagaaggagacgcagccagaggagccagtccctgattccatgggggatttggaaaatgtaaagcctatgtcagggccgtggtccactgttaatcctgtgagagtgttggtgcccaaattccggcacctttggcgacacaacttcaatgtgctgcaactacaagagctggagagcatcttccagtgcaatcactacatcagcactacagaggaaaatcgcctggcaagatccatgggtgtgagtgaagccacagtgcaggaatggtttttgaagaggagagagaaatacaggagttataagaggctgtaaaggctcagaggtcctcttcctgcattccggagcatctctgtgtgaaggctatggagaagccccaggcagccacccatgctcaagtcactgtagacagacgatgttgtgccgccaaagccctgttacaacacagttatctcctcaatacttgtatttgcaataaagagctgaattc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]