2025-07-09 15:00:38, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_001100465 779 bp mRNA linear ROD 07-AUG-2023 DEFINITION Mus musculus reproductive homeobox 2H (Rhox2h), mRNA. ACCESSION NM_001100465 XM_886726 VERSION NM_001100465.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 779) AUTHORS MacLean,J.A. 2nd, Lorenzetti,D., Hu,Z., Salerno,W.J., Miller,J. and Wilkinson,M.F. TITLE Rhox homeobox gene cluster: recent duplication of three family members JOURNAL Genesis 44 (3), 122-129 (2006) PUBMED 16496311 REFERENCE 2 (bases 1 to 779) AUTHORS Morris L, Gordon J and Blackburn CC. TITLE Identification of a tandem duplicated array in the Rhox alpha locus on mouse chromosome X JOURNAL Mamm Genome 17 (2), 178-187 (2006) PUBMED 16465597 REFERENCE 3 (bases 1 to 779) AUTHORS Maclean JA 2nd, Chen MA, Wayne CM, Bruce SR, Rao M, Meistrich ML, Macleod C and Wilkinson MF. TITLE Rhox: a new homeobox gene cluster JOURNAL Cell 120 (3), 369-382 (2005) PUBMED 15707895 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AL808133.17. On Aug 4, 2007 this sequence version replaced XM_886726.3. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. ##Evidence-Data-START## RNAseq introns :: single sample supports all introns SAMN00849384, SAMN01164134 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## inferred exon combination :: based on alignments, homology RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-95 AL808133.17 152981-153075 c 96-507 AL808133.17 152407-152818 c 508-553 AL808133.17 150818-150863 c 554-779 AL808133.17 148795-149020 c FEATURES Location/Qualifiers source 1..779 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="X" /map="X 21.98 cM" gene 1..779 /gene="Rhox2h" /gene_synonym="Rhox2.8; Rhox2g" /note="reproductive homeobox 2H" /db_xref="GeneID:622301" /db_xref="MGI:MGI:3713490" exon 1..95 /gene="Rhox2h" /gene_synonym="Rhox2.8; Rhox2g" /inference="alignment:Splign:2.1.0" CDS 29..604 /gene="Rhox2h" /gene_synonym="Rhox2.8; Rhox2g" /note="reproductive homeobox 2G" /codon_start=1 /product="reproductive homeobox 2H" /protein_id="NP_001093935.1" /db_xref="CCDS:CCDS40942.1" /db_xref="GeneID:622301" /db_xref="MGI:MGI:3713490" /translation="
MEKRSINYLLDVGPEEDEENANGVKTLMVLLAGEGRNEGESGRGLPGSGVSAAEGYRAGELSAGGPAAPVAGLMDNSNQEDLSATGCAQEKETQPEEPVPDSMGDLENVKPMSGPWSTVNPVRVLVPKFRHLWRHNFNVLQLQELESIFQCNHYISTTEENRLARSMGVSEATVQEWFLKRREKYRSYKRL"
misc_feature 428..586 /gene="Rhox2h" /gene_synonym="Rhox2.8; Rhox2g" /note="Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner; Region: homeodomain; cd00086" /db_xref="CDD:238039" misc_feature order(434..436,554..556,563..568,575..577) /gene="Rhox2h" /gene_synonym="Rhox2.8; Rhox2g" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 96..507 /gene="Rhox2h" /gene_synonym="Rhox2.8; Rhox2g" /inference="alignment:Splign:2.1.0" exon 508..553 /gene="Rhox2h" /gene_synonym="Rhox2.8; Rhox2g" /inference="alignment:Splign:2.1.0" exon 554..779 /gene="Rhox2h" /gene_synonym="Rhox2.8; Rhox2g" /inference="alignment:Splign:2.1.0" ORIGIN
gaataacgacttccacggctttacagacatggagaaaagaagcatcaattacctgcttgatgtgggacctgaggaggatgaggaaaatgcgaatggtgtaaagactctgatggtcttgctggctggagagggaagaaacgagggagagagtggacggggcctgcctgggtcgggagtctcagcagcggaaggatacagagcaggagaattaagtgcaggtgggccggctgcgcctgtagcaggcctcatggataacagcaaccaagaggaccttagtgccactggctgtgcccaggagaaggagacgcagccagaggagccagtccctgattccatgggggatttggaaaatgtaaagcctatgtcagggccgtggtccactgttaatcctgtgagagtgttggtgcccaaattccggcacctttggcgacacaacttcaatgtgctgcaactacaagagctggagagcatcttccagtgcaatcactacatcagcactacagaggaaaatcgcctggcaagatccatgggtgtgagtgaagccacagtgcaggaatggtttttgaagaggagagagaaatacaggagttataagaggctgtaaaggctcagaggtcctcttcctgcattccggagcatctctgtgtgaaggctatggagaagccccaggcagccacccatgctcaagtcactgtagacagacgatgttgtgccgccaaagccctgttacaacacagttatctcctcaatacttgtatttgcaataaagagctgaattc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]