2025-10-13 22:42:45, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS NM_001081669 795 bp mRNA linear ROD 04-AUG-2023 DEFINITION Mus musculus reproductive homeobox 2D (Rhox2d), mRNA. ACCESSION NM_001081669 XM_486653 VERSION NM_001081669.2 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 795) AUTHORS MacLean,J.A. 2nd, Lorenzetti,D., Hu,Z., Salerno,W.J., Miller,J. and Wilkinson,M.F. TITLE Rhox homeobox gene cluster: recent duplication of three family members JOURNAL Genesis 44 (3), 122-129 (2006) PUBMED 16496311 REFERENCE 2 (bases 1 to 795) AUTHORS Morris L, Gordon J and Blackburn CC. TITLE Identification of a tandem duplicated array in the Rhox alpha locus on mouse chromosome X JOURNAL Mamm Genome 17 (2), 178-187 (2006) PUBMED 16465597 REFERENCE 3 (bases 1 to 795) AUTHORS Maclean JA 2nd, Chen MA, Wayne CM, Bruce SR, Rao M, Meistrich ML, Macleod C and Wilkinson MF. TITLE Rhox: a new homeobox gene cluster JOURNAL Cell 120 (3), 369-382 (2005) PUBMED 15707895 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AL954686.9. On Mar 20, 2007 this sequence version replaced NM_001081669.1. ##Evidence-Data-START## RNAseq introns :: single sample supports all introns SAMN01164134, SAMN01164142 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-106 AL954686.9 49253-49358 107-518 AL954686.9 49522-49933 519-564 AL954686.9 51490-51535 565-795 AL954686.9 53328-53558 FEATURES Location/Qualifiers source 1..795 /organism="Mus musculus" /mol_type="mRNA" /db_xref="taxon:10090" /chromosome="X" /map="X 21.79 cM" gene 1..795 /gene="Rhox2d" /gene_synonym="EG434760; Rhox2.4; Rhox2c" /note="reproductive homeobox 2D" /db_xref="GeneID:434760" /db_xref="MGI:MGI:3648779" exon 1..106 /gene="Rhox2d" /gene_synonym="EG434760; Rhox2.4; Rhox2c" /inference="alignment:Splign:2.1.0" CDS 40..615 /gene="Rhox2d" /gene_synonym="EG434760; Rhox2.4; Rhox2c" /note="reproductive homeobox 2C" /codon_start=1 /product="reproductive homeobox 2D" /protein_id="NP_001075138.2" /db_xref="CCDS:CCDS40934.1" /db_xref="GeneID:434760" /db_xref="MGI:MGI:3648779" /translation="
MEQQSINYKLDVGPEEDEENANGVKTLMVLLAGEGRNEGESGPGLPGSGVSAAEGYRAGELSAGGLASPVADLMDKSNQEDLSATGCAQEKEKQPEEPVPDSMGDLENVKPMSGPWSTVNPVRVLVPEFRYSWQQSFNVLQLQELESIFQCNQYISTTEAKRLAKSMGVSEATVQEWFLKRREKYRSYKRL"
misc_feature 439..597 /gene="Rhox2d" /gene_synonym="EG434760; Rhox2.4; Rhox2c" /note="Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner; Region: homeodomain; cd00086" /db_xref="CDD:238039" misc_feature order(445..447,565..567,574..579,586..588) /gene="Rhox2d" /gene_synonym="EG434760; Rhox2.4; Rhox2c" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 107..518 /gene="Rhox2d" /gene_synonym="EG434760; Rhox2.4; Rhox2c" /inference="alignment:Splign:2.1.0" exon 519..564 /gene="Rhox2d" /gene_synonym="EG434760; Rhox2.4; Rhox2c" /inference="alignment:Splign:2.1.0" exon 565..795 /gene="Rhox2d" /gene_synonym="EG434760; Rhox2.4; Rhox2c" /inference="alignment:Splign:2.1.0" regulatory 774..779 /regulatory_class="polyA_signal_sequence" /gene="Rhox2d" /gene_synonym="EG434760; Rhox2.4; Rhox2c" polyA_site 794 /gene="Rhox2d" /gene_synonym="EG434760; Rhox2.4; Rhox2c" ORIGIN
ggtgtaacagtgaataacgacttccacggctttacagacatggagcaacaaagcatcaattacaagcttgatgtgggacctgaggaggatgaggaaaatgcgaatggtgtaaagactctgatggtgttgctggctggagagggaagaaacgagggagagagtggaccgggcctgcctgggtcgggagtctcagcagcggaaggatacagagcaggagaattaagtgcaggtgggcttgcttcgccagtagccgacctcatggataagagcaaccaagaggaccttagtgccactggctgtgcccaggagaaggagaagcagccagaggagccagtccctgattccatgggggatttggaaaatgtaaagcctatgtcagggccgtggtccactgttaatcctgtgagagtgttggtgcccgaattccgctacagttggcaacagagcttcaatgtgctgcaactacaagagctggagagcatcttccagtgcaatcaatacatcagcactacagaggcaaaacgtctggcaaaatccatgggtgtgagtgaagccacagtgcaggaatggtttttgaagaggagagagaaatacaggagttataagaggctgtaaaggctcagaggtcctcttcctgcattccggagcatctctctgtgaaggctgtggagaagccccaggcagccacccatgctcaagtcactgtagacagatgatgttgtgccgccaaagtcctgttacaacacagttatcttcttaatacttgtatttgcaataaagagctgaattctcaat
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]