GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-10-13 22:42:45, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       NM_001081669             795 bp    mRNA    linear   ROD 04-AUG-2023
DEFINITION  Mus musculus reproductive homeobox 2D (Rhox2d), mRNA.
ACCESSION   NM_001081669 XM_486653
VERSION     NM_001081669.2
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 795)
  AUTHORS   MacLean,J.A. 2nd, Lorenzetti,D., Hu,Z., Salerno,W.J., Miller,J. and
            Wilkinson,M.F.
  TITLE     Rhox homeobox gene cluster: recent duplication of three family
            members
  JOURNAL   Genesis 44 (3), 122-129 (2006)
   PUBMED   16496311
REFERENCE   2  (bases 1 to 795)
  AUTHORS   Morris L, Gordon J and Blackburn CC.
  TITLE     Identification of a tandem duplicated array in the Rhox alpha locus
            on mouse chromosome X
  JOURNAL   Mamm Genome 17 (2), 178-187 (2006)
   PUBMED   16465597
REFERENCE   3  (bases 1 to 795)
  AUTHORS   Maclean JA 2nd, Chen MA, Wayne CM, Bruce SR, Rao M, Meistrich ML,
            Macleod C and Wilkinson MF.
  TITLE     Rhox: a new homeobox gene cluster
  JOURNAL   Cell 120 (3), 369-382 (2005)
   PUBMED   15707895
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AL954686.9.
            
            On Mar 20, 2007 this sequence version replaced NM_001081669.1.
            
            ##Evidence-Data-START##
            RNAseq introns :: single sample supports all introns SAMN01164134,
                              SAMN01164142 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-106               AL954686.9         49253-49358
            107-518             AL954686.9         49522-49933
            519-564             AL954686.9         51490-51535
            565-795             AL954686.9         53328-53558
FEATURES             Location/Qualifiers
     source          1..795
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /db_xref="taxon:10090"
                     /chromosome="X"
                     /map="X 21.79 cM"
     gene            1..795
                     /gene="Rhox2d"
                     /gene_synonym="EG434760; Rhox2.4; Rhox2c"
                     /note="reproductive homeobox 2D"
                     /db_xref="GeneID:434760"
                     /db_xref="MGI:MGI:3648779"
     exon            1..106
                     /gene="Rhox2d"
                     /gene_synonym="EG434760; Rhox2.4; Rhox2c"
                     /inference="alignment:Splign:2.1.0"
     CDS             40..615
                     /gene="Rhox2d"
                     /gene_synonym="EG434760; Rhox2.4; Rhox2c"
                     /note="reproductive homeobox 2C"
                     /codon_start=1
                     /product="reproductive homeobox 2D"
                     /protein_id="NP_001075138.2"
                     /db_xref="CCDS:CCDS40934.1"
                     /db_xref="GeneID:434760"
                     /db_xref="MGI:MGI:3648779"
                     /translation="
MEQQSINYKLDVGPEEDEENANGVKTLMVLLAGEGRNEGESGPGLPGSGVSAAEGYRAGELSAGGLASPVADLMDKSNQEDLSATGCAQEKEKQPEEPVPDSMGDLENVKPMSGPWSTVNPVRVLVPEFRYSWQQSFNVLQLQELESIFQCNQYISTTEAKRLAKSMGVSEATVQEWFLKRREKYRSYKRL"
     misc_feature    439..597
                     /gene="Rhox2d"
                     /gene_synonym="EG434760; Rhox2.4; Rhox2c"
                     /note="Homeodomain; DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:238039"
     misc_feature    order(445..447,565..567,574..579,586..588)
                     /gene="Rhox2d"
                     /gene_synonym="EG434760; Rhox2.4; Rhox2c"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            107..518
                     /gene="Rhox2d"
                     /gene_synonym="EG434760; Rhox2.4; Rhox2c"
                     /inference="alignment:Splign:2.1.0"
     exon            519..564
                     /gene="Rhox2d"
                     /gene_synonym="EG434760; Rhox2.4; Rhox2c"
                     /inference="alignment:Splign:2.1.0"
     exon            565..795
                     /gene="Rhox2d"
                     /gene_synonym="EG434760; Rhox2.4; Rhox2c"
                     /inference="alignment:Splign:2.1.0"
     regulatory      774..779
                     /regulatory_class="polyA_signal_sequence"
                     /gene="Rhox2d"
                     /gene_synonym="EG434760; Rhox2.4; Rhox2c"
     polyA_site      794
                     /gene="Rhox2d"
                     /gene_synonym="EG434760; Rhox2.4; Rhox2c"
ORIGIN      
ggtgtaacagtgaataacgacttccacggctttacagacatggagcaacaaagcatcaattacaagcttgatgtgggacctgaggaggatgaggaaaatgcgaatggtgtaaagactctgatggtgttgctggctggagagggaagaaacgagggagagagtggaccgggcctgcctgggtcgggagtctcagcagcggaaggatacagagcaggagaattaagtgcaggtgggcttgcttcgccagtagccgacctcatggataagagcaaccaagaggaccttagtgccactggctgtgcccaggagaaggagaagcagccagaggagccagtccctgattccatgggggatttggaaaatgtaaagcctatgtcagggccgtggtccactgttaatcctgtgagagtgttggtgcccgaattccgctacagttggcaacagagcttcaatgtgctgcaactacaagagctggagagcatcttccagtgcaatcaatacatcagcactacagaggcaaaacgtctggcaaaatccatgggtgtgagtgaagccacagtgcaggaatggtttttgaagaggagagagaaatacaggagttataagaggctgtaaaggctcagaggtcctcttcctgcattccggagcatctctctgtgaaggctgtggagaagccccaggcagccacccatgctcaagtcactgtagacagatgatgttgtgccgccaaagtcctgttacaacacagttatcttcttaatacttgtatttgcaataaagagctgaattctcaat
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]