GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-07-19 08:48:31, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       NM_001039698             978 bp    mRNA    linear   ROD 04-AUG-2023
DEFINITION  Mus musculus reproductive homeobox 4G (Rhox4g), mRNA.
ACCESSION   NM_001039698 XM_486663
VERSION     NM_001039698.1
KEYWORDS    RefSeq; RefSeq Select.
SOURCE      Mus musculus (house mouse)
  ORGANISM  Mus musculus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
            Muroidea; Muridae; Murinae; Mus; Mus.
REFERENCE   1  (bases 1 to 978)
  AUTHORS   Leduc MS, Savage HS, Stearns TM, Cario CL, Walsh KA, Paigen B and
            Berndt A.
  TITLE     A major X-linked locus affects kidney function in mice
  JOURNAL   Mol Genet Genomics 287 (11-12), 845-854 (2012)
   PUBMED   23011808
REFERENCE   2  (bases 1 to 978)
  AUTHORS   MacLean,J.A. 2nd, Lorenzetti,D., Hu,Z., Salerno,W.J., Miller,J. and
            Wilkinson,M.F.
  TITLE     Rhox homeobox gene cluster: recent duplication of three family
            members
  JOURNAL   Genesis 44 (3), 122-129 (2006)
   PUBMED   16496311
REFERENCE   3  (bases 1 to 978)
  AUTHORS   Morris L, Gordon J and Blackburn CC.
  TITLE     Identification of a tandem duplicated array in the Rhox alpha locus
            on mouse chromosome X
  JOURNAL   Mamm Genome 17 (2), 178-187 (2006)
   PUBMED   16465597
REFERENCE   4  (bases 1 to 978)
  AUTHORS   Maclean JA 2nd, Chen MA, Wayne CM, Bruce SR, Rao M, Meistrich ML,
            Macleod C and Wilkinson MF.
  TITLE     Rhox: a new homeobox gene cluster
  JOURNAL   Cell 120 (3), 369-382 (2005)
   PUBMED   15707895
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AJ972671.1.
            
            On May 4, 2006 this sequence version replaced XM_486663.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AJ972671.1, BU756829.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN01164134 [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            RefSeq Select criteria :: based on single protein-coding transcript
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
FEATURES             Location/Qualifiers
     source          1..978
                     /organism="Mus musculus"
                     /mol_type="mRNA"
                     /strain="C57BL/6"
                     /db_xref="taxon:10090"
                     /chromosome="X"
                     /map="X 21.95 cM"
     gene            1..978
                     /gene="Rhox4g"
                     /gene_synonym="Rhox4.6; Rhox4.7; Rhox4f"
                     /note="reproductive homeobox 4G"
                     /db_xref="GeneID:664608"
                     /db_xref="MGI:MGI:3613394"
     exon            1..290
                     /gene="Rhox4g"
                     /gene_synonym="Rhox4.6; Rhox4.7; Rhox4f"
                     /inference="alignment:Splign:2.1.0"
     CDS             224..841
                     /gene="Rhox4g"
                     /gene_synonym="Rhox4.6; Rhox4.7; Rhox4f"
                     /note="reproductive homeobox 4F"
                     /codon_start=1
                     /product="reproductive homeobox 4G"
                     /protein_id="NP_001034787.1"
                     /db_xref="CCDS:CCDS40940.1"
                     /db_xref="GeneID:664608"
                     /db_xref="MGI:MGI:3613394"
                     /translation="
MEHQNTNYLLHEGLGKDKEKLNGGKTQAVLPLDGEGRNEGESGLGQSGAAAVEGDKAEELSGEGGPAAGDADLMDNSNQEDQDTSGSAQEEEKLPEEPVLRDAVVIDKVQPIPVLVSGVRPKSVWVQQRSLHYNFQWWQLQELERIFQQNHFIRAEERRHLARWIGVSEARVMTWFKKRREHFRRGQSQLGMNDDAPVGSHSTFL"
     misc_feature    608..784
                     /gene="Rhox4g"
                     /gene_synonym="Rhox4.6; Rhox4.7; Rhox4f"
                     /note="Homeodomain; DNA binding domains involved in the
                     transcriptional regulation of key eukaryotic developmental
                     processes; may bind to DNA as monomers or as homo- and/or
                     heterodimers, in a sequence-specific manner; Region:
                     homeodomain; cd00086"
                     /db_xref="CDD:238039"
     misc_feature    order(608..622,626..628,677..679,695..697,734..736,
                     740..745,752..757,761..769,773..778)
                     /gene="Rhox4g"
                     /gene_synonym="Rhox4.6; Rhox4.7; Rhox4f"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    order(614..616,623..625,743..745,752..757,764..766)
                     /gene="Rhox4g"
                     /gene_synonym="Rhox4.6; Rhox4.7; Rhox4f"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     exon            291..696
                     /gene="Rhox4g"
                     /gene_synonym="Rhox4.6; Rhox4.7; Rhox4f"
                     /inference="alignment:Splign:2.1.0"
     exon            697..742
                     /gene="Rhox4g"
                     /gene_synonym="Rhox4.6; Rhox4.7; Rhox4f"
                     /inference="alignment:Splign:2.1.0"
     exon            743..978
                     /gene="Rhox4g"
                     /gene_synonym="Rhox4.6; Rhox4.7; Rhox4f"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
ctggttgcaaagccaggcttttggctttcggctttcggctttcggctttcggctttcggctttcggctttcggctttcggctttcggctttcggctttcggctttcggctttcggctttcggctttcggctttcggctttcggcttttgcctttcagctttcaaaacctcaggagctccgactcagaatctgctggggaaagctgcagggaagcactcaggacatggagcatcaaaacaccaactacctacttcatgagggacttggcaaggacaaggaaaagttgaatggtgggaagacacaggcagtcttaccactggatggagagggaagaaatgagggagagagtggactgggccagtccggagccgcagcagtggaaggggacaaagcagaagaattaagtggagaaggtgggcctgctgctggtgatgcagacctcatggataacagcaaccaagaggaccaggacaccagtggcagtgcccaggaggaggagaagctgccagaggagccagttctcagggatgctgtggtcatagacaaagtgcagcctattccagtgctggtatctggtgtgcggcctaagtcagtgtgggtacagcagcgtagcttacactacaatttccaatggtggcagctgcaggagctggagcgcattttccagcagaatcacttcatccgtgcagaggaaagaagacatctggcaagatggataggtgtgagtgaagccagagttatgacatggtttaagaagaggagagagcacttcagaagaggacaaagtcagttaggaatgaatgatgatgcccctgtggggtcccactctacctttctctgaagatggcacaggaggcctggtgtaccacccttgaccaggagccacgtgcagacccctgctgccttccaccagcatgttattgcatctctatcccctaagcatttgtatgtgaaataaatagattctcagttactttg
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]