ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-07-04 22:24:43, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS NM_001039698 978 bp mRNA linear ROD 04-AUG-2023 DEFINITION Mus musculus reproductive homeobox 4G (Rhox4g), mRNA. ACCESSION NM_001039698 XM_486663 VERSION NM_001039698.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 978) AUTHORS Leduc MS, Savage HS, Stearns TM, Cario CL, Walsh KA, Paigen B and Berndt A. TITLE A major X-linked locus affects kidney function in mice JOURNAL Mol Genet Genomics 287 (11-12), 845-854 (2012) PUBMED 23011808 REFERENCE 2 (bases 1 to 978) AUTHORS MacLean,J.A. 2nd, Lorenzetti,D., Hu,Z., Salerno,W.J., Miller,J. and Wilkinson,M.F. TITLE Rhox homeobox gene cluster: recent duplication of three family members JOURNAL Genesis 44 (3), 122-129 (2006) PUBMED 16496311 REFERENCE 3 (bases 1 to 978) AUTHORS Morris L, Gordon J and Blackburn CC. TITLE Identification of a tandem duplicated array in the Rhox alpha locus on mouse chromosome X JOURNAL Mamm Genome 17 (2), 178-187 (2006) PUBMED 16465597 REFERENCE 4 (bases 1 to 978) AUTHORS Maclean JA 2nd, Chen MA, Wayne CM, Bruce SR, Rao M, Meistrich ML, Macleod C and Wilkinson MF. TITLE Rhox: a new homeobox gene cluster JOURNAL Cell 120 (3), 369-382 (2005) PUBMED 15707895 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AJ972671.1. On May 4, 2006 this sequence version replaced XM_486663.1. ##Evidence-Data-START## Transcript exon combination :: AJ972671.1, BU756829.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN01164134 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. FEATURES Location/Qualifiers source 1..978 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="X" /map="X 21.95 cM" gene 1..978 /gene="Rhox4g" /gene_synonym="Rhox4.6; Rhox4.7; Rhox4f" /note="reproductive homeobox 4G" /db_xref="GeneID:664608" /db_xref="MGI:MGI:3613394" exon 1..290 /gene="Rhox4g" /gene_synonym="Rhox4.6; Rhox4.7; Rhox4f" /inference="alignment:Splign:2.1.0" CDS 224..841 /gene="Rhox4g" /gene_synonym="Rhox4.6; Rhox4.7; Rhox4f" /note="reproductive homeobox 4F" /codon_start=1 /product="reproductive homeobox 4G" /protein_id="NP_001034787.1" /db_xref="CCDS:CCDS40940.1" /db_xref="GeneID:664608" /db_xref="MGI:MGI:3613394" /translation="
MEHQNTNYLLHEGLGKDKEKLNGGKTQAVLPLDGEGRNEGESGLGQSGAAAVEGDKAEELSGEGGPAAGDADLMDNSNQEDQDTSGSAQEEEKLPEEPVLRDAVVIDKVQPIPVLVSGVRPKSVWVQQRSLHYNFQWWQLQELERIFQQNHFIRAEERRHLARWIGVSEARVMTWFKKRREHFRRGQSQLGMNDDAPVGSHSTFL"
misc_feature 608..784
/gene="Rhox4g"
/gene_synonym="Rhox4.6; Rhox4.7; Rhox4f"
/note="Homeodomain; DNA binding domains involved in the
transcriptional regulation of key eukaryotic developmental
processes; may bind to DNA as monomers or as homo- and/or
heterodimers, in a sequence-specific manner; Region:
homeodomain; cd00086"
/db_xref="CDD:238039"
misc_feature order(608..622,626..628,677..679,695..697,734..736,
740..745,752..757,761..769,773..778)
/gene="Rhox4g"
/gene_synonym="Rhox4.6; Rhox4.7; Rhox4f"
/note="DNA binding site [nucleotide binding]"
/db_xref="CDD:238039"
misc_feature order(614..616,623..625,743..745,752..757,764..766)
/gene="Rhox4g"
/gene_synonym="Rhox4.6; Rhox4.7; Rhox4f"
/note="specific DNA base contacts [nucleotide binding];
other site"
/db_xref="CDD:238039"
exon 291..696
/gene="Rhox4g"
/gene_synonym="Rhox4.6; Rhox4.7; Rhox4f"
/inference="alignment:Splign:2.1.0"
exon 697..742
/gene="Rhox4g"
/gene_synonym="Rhox4.6; Rhox4.7; Rhox4f"
/inference="alignment:Splign:2.1.0"
exon 743..978
/gene="Rhox4g"
/gene_synonym="Rhox4.6; Rhox4.7; Rhox4f"
/inference="alignment:Splign:2.1.0"
ORIGIN
ctggttgcaaagccaggcttttggctttcggctttcggctttcggctttcggctttcggctttcggctttcggctttcggctttcggctttcggctttcggctttcggctttcggctttcggctttcggctttcggctttcggcttttgcctttcagctttcaaaacctcaggagctccgactcagaatctgctggggaaagctgcagggaagcactcaggacatggagcatcaaaacaccaactacctacttcatgagggacttggcaaggacaaggaaaagttgaatggtgggaagacacaggcagtcttaccactggatggagagggaagaaatgagggagagagtggactgggccagtccggagccgcagcagtggaaggggacaaagcagaagaattaagtggagaaggtgggcctgctgctggtgatgcagacctcatggataacagcaaccaagaggaccaggacaccagtggcagtgcccaggaggaggagaagctgccagaggagccagttctcagggatgctgtggtcatagacaaagtgcagcctattccagtgctggtatctggtgtgcggcctaagtcagtgtgggtacagcagcgtagcttacactacaatttccaatggtggcagctgcaggagctggagcgcattttccagcagaatcacttcatccgtgcagaggaaagaagacatctggcaagatggataggtgtgagtgaagccagagttatgacatggtttaagaagaggagagagcacttcagaagaggacaaagtcagttaggaatgaatgatgatgcccctgtggggtcccactctacctttctctgaagatggcacaggaggcctggtgtaccacccttgaccaggagccacgtgcagacccctgctgccttccaccagcatgttattgcatctctatcccctaagcatttgtatgtgaaataaatagattctcagttactttg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]