2024-09-28 11:16:10, GGRNA.v2 : RefSeq release 225 (Jul, 2024)
LOCUS NM_001039689 903 bp mRNA linear ROD 04-AUG-2023 DEFINITION Mus musculus reproductive homeobox 4C (Rhox4c), mRNA. ACCESSION NM_001039689 XM_486652 XM_911553 VERSION NM_001039689.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 903) AUTHORS MacLean,J.A. 2nd, Lorenzetti,D., Hu,Z., Salerno,W.J., Miller,J. and Wilkinson,M.F. TITLE Rhox homeobox gene cluster: recent duplication of three family members JOURNAL Genesis 44 (3), 122-129 (2006) PUBMED 16496311 REFERENCE 2 (bases 1 to 903) AUTHORS Morris L, Gordon J and Blackburn CC. TITLE Identification of a tandem duplicated array in the Rhox alpha locus on mouse chromosome X JOURNAL Mamm Genome 17 (2), 178-187 (2006) PUBMED 16465597 REFERENCE 3 (bases 1 to 903) AUTHORS Maclean JA 2nd, Chen MA, Wayne CM, Bruce SR, Rao M, Meistrich ML, Macleod C and Wilkinson MF. TITLE Rhox: a new homeobox gene cluster JOURNAL Cell 120 (3), 369-382 (2005) PUBMED 15707895 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AJ972667.1. On or before Mar 8, 2006 this sequence version replaced XM_911553.1, XM_486652.3. ##Evidence-Data-START## Transcript exon combination :: AJ972667.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN01164134, SAMN01164142 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on expression, longest protein ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. FEATURES Location/Qualifiers source 1..903 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="X" /map="X 21.78 cM" gene 1..903 /gene="Rhox4c" /gene_synonym="Rhox4.3; Rhox4b" /note="reproductive homeobox 4C" /db_xref="GeneID:434759" /db_xref="MGI:MGI:3613386" exon 1..215 /gene="Rhox4c" /gene_synonym="Rhox4.3; Rhox4b" /inference="alignment:Splign:2.1.0" CDS 149..766 /gene="Rhox4c" /gene_synonym="Rhox4.3; Rhox4b" /codon_start=1 /product="reproductive homeobox 4C" /protein_id="NP_001034778.1" /db_xref="CCDS:CCDS40933.1" /db_xref="GeneID:434759" /db_xref="MGI:MGI:3613386" /translation="
MEHQNTNYLLHEGLGKDKEKLNGGKTQAVLPLDGEGRNEGESVLGQSGAAAVEGDKAEELSGEGGPAAGDADLMDNSNQEDQDTSGSAQEEEKLPEEPVLKDAVVIDKVQPIPVLVSGVRPKSVWVQQRSLHYNFQWWQLQELERIFQQNHFIRAEERRHLARWIGVSETRVKRWFKKRREHFRRGQSQLGMNDDAPVGSHSTFL"
misc_feature 533..709 /gene="Rhox4c" /gene_synonym="Rhox4.3; Rhox4b" /note="Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner; Region: homeodomain; cd00086" /db_xref="CDD:238039" misc_feature order(533..547,551..553,602..604,620..622,659..661, 665..670,677..682,686..694,698..703) /gene="Rhox4c" /gene_synonym="Rhox4.3; Rhox4b" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(539..541,548..550,668..670,677..682,689..691) /gene="Rhox4c" /gene_synonym="Rhox4.3; Rhox4b" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 216..621 /gene="Rhox4c" /gene_synonym="Rhox4.3; Rhox4b" /inference="alignment:Splign:2.1.0" exon 622..667 /gene="Rhox4c" /gene_synonym="Rhox4.3; Rhox4b" /inference="alignment:Splign:2.1.0" exon 668..903 /gene="Rhox4c" /gene_synonym="Rhox4.3; Rhox4b" /inference="alignment:Splign:2.1.0" ORIGIN
gttagctttcagctttcggctttcggctttcggctttcggctttcggctttcggcttttgcctttcggcttttgcctttcagctttcaaaacctcaggagctccgactcagaatctgctggggaaagctgcagggaagccctcaggacatggagcatcaaaacaccaactacctacttcatgagggacttggcaaggacaaggaaaagttgaatggtgggaagacacaggcagtcttaccactggatggagagggaagaaatgagggagagagtgtactgggccagtccggagccgcagcagtggaaggggacaaagcagaagaattaagtggagaaggtgggcctgctgctggtgatgcagacctcatggataacagcaaccaagaggaccaggacaccagtggcagtgcccaggaggaggagaagctgccagaggagccagttctcaaggatgctgtggtcatagacaaagtgcagcctattccagtgctggtatctggtgtgcggcctaagtcagtgtgggtacagcagcgtagcttacactacaatttccaatggtggcagctgcaggagctggagcgcattttccagcagaatcacttcatccgtgcagaggaaagaagacatctggcaagatggataggtgtgagtgaaaccagagttaagagatggtttaagaagaggagagagcacttcagaagaggacaaagtcagttaggaatgaatgacgatgcccctgtggggtcccactctacctttctctgaagatggcacaggaggcctggtgtaccacccttgaccaggagccacgtgcagacacctgctgtcttccaccagcatgttattgcaactctattccctaagcatttgtatgtgaaataaatagattctcagtttctttg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]