2025-09-16 20:13:17, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS NM_001039688 891 bp mRNA linear ROD 04-AUG-2023 DEFINITION Mus musculus reproductive homeobox 4A (Rhox4a), mRNA. ACCESSION NM_001039688 XM_975797 XM_975830 VERSION NM_001039688.3 KEYWORDS RefSeq; RefSeq Select. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus. REFERENCE 1 (bases 1 to 891) AUTHORS Daggag H, Svingen T, Western PS, van den Bergen JA, McClive PJ, Harley VR, Koopman P and Sinclair AH. TITLE The rhox homeobox gene family shows sexually dimorphic and dynamic expression during mouse embryonic gonad development JOURNAL Biol Reprod 79 (3), 468-474 (2008) PUBMED 18562707 REFERENCE 2 (bases 1 to 891) AUTHORS MacLean,J.A. 2nd, Lorenzetti,D., Hu,Z., Salerno,W.J., Miller,J. and Wilkinson,M.F. TITLE Rhox homeobox gene cluster: recent duplication of three family members JOURNAL Genesis 44 (3), 122-129 (2006) PUBMED 16496311 REFERENCE 3 (bases 1 to 891) AUTHORS Morris L, Gordon J and Blackburn CC. TITLE Identification of a tandem duplicated array in the Rhox alpha locus on mouse chromosome X JOURNAL Mamm Genome 17 (2), 178-187 (2006) PUBMED 16465597 REFERENCE 4 (bases 1 to 891) AUTHORS Maclean JA 2nd, Chen MA, Wayne CM, Bruce SR, Rao M, Meistrich ML, Macleod C and Wilkinson MF. TITLE Rhox: a new homeobox gene cluster JOURNAL Cell 120 (3), 369-382 (2005) PUBMED 15707895 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AJ972665.1. On May 28, 2010 this sequence version replaced NM_001039688.2. ##Evidence-Data-START## Transcript exon combination :: AJ972665.1, BC057925.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMN00849383, SAMN01164134 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## RefSeq Select criteria :: based on expression, longest protein ##RefSeq-Attributes-END## COMPLETENESS: complete on the 3' end. FEATURES Location/Qualifiers source 1..891 /organism="Mus musculus" /mol_type="mRNA" /strain="C57BL/6" /db_xref="taxon:10090" /chromosome="X" /map="X 21.69 cM" gene 1..891 /gene="Rhox4a" /gene_synonym="Rhox4; Rhox4.1" /note="reproductive homeobox 4A" /db_xref="GeneID:664609" /db_xref="MGI:MGI:3580240" exon 1..203 /gene="Rhox4a" /gene_synonym="Rhox4; Rhox4.1" /inference="alignment:Splign:2.1.0" misc_feature 74..76 /gene="Rhox4a" /gene_synonym="Rhox4; Rhox4.1" /note="upstream in-frame stop codon" CDS 137..754 /gene="Rhox4a" /gene_synonym="Rhox4; Rhox4.1" /codon_start=1 /product="reproductive homeobox 4A" /protein_id="NP_001034777.1" /db_xref="CCDS:CCDS40930.1" /db_xref="GeneID:664609" /db_xref="MGI:MGI:3580240" /translation="
MEHQNTNYLLHEGLGKDKENLNGGKTQAVLPLDGEGRNEGESVLGQSGAAAVEGDKAEELSGEGGPAAGDADLMDNSNQEDQDTSGSAQEEEKLPEEPVLKDAVVIDKVQPIPVLVSGVRPKSVWVQQRSLHYNFQWWQLQELERIFQQNHFIRAEERRHLARWIGVSEARVKRWFKKRREHFRRGQSQLGMNDDASVGSHSTFL"
misc_feature 521..697 /gene="Rhox4a" /gene_synonym="Rhox4; Rhox4.1" /note="Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner; Region: homeodomain; cd00086" /db_xref="CDD:238039" misc_feature order(521..535,539..541,590..592,608..610,647..649, 653..658,665..670,674..682,686..691) /gene="Rhox4a" /gene_synonym="Rhox4; Rhox4.1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(527..529,536..538,656..658,665..670,677..679) /gene="Rhox4a" /gene_synonym="Rhox4; Rhox4.1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" exon 204..609 /gene="Rhox4a" /gene_synonym="Rhox4; Rhox4.1" /inference="alignment:Splign:2.1.0" exon 610..655 /gene="Rhox4a" /gene_synonym="Rhox4; Rhox4.1" /inference="alignment:Splign:2.1.0" exon 656..891 /gene="Rhox4a" /gene_synonym="Rhox4; Rhox4.1" /inference="alignment:Splign:2.1.0" ORIGIN
ctttcggctttcggctttcggctttcggctttcggctgtcagctttcggctgtcggctttcagctttcggttttgacaacctcaggaactccgactcagaatctgctggggaaagctgcagggaagcactcaggacatggagcatcaaaacaccaactacctacttcatgagggacttggcaaggacaaggaaaatttgaatggtgggaagacacaggcagtcttaccactggatggagagggaagaaatgagggagagagtgtactgggccagtccggagccgcagcagtggaaggggacaaagcagaagaattaagtggagaaggtgggcctgctgctggtgatgcagacctcatggataacagcaaccaagaggaccaggacaccagtggcagtgcccaggaggaggagaagctgccagaggagccagttctcaaggatgctgtggtcatagacaaagtgcagcctattccagtgctggtatctggtgtgcggcctaagtcagtgtgggtacagcagcgtagcttacactacaatttccaatggtggcagctgcaggagctggagcgcattttccagcagaatcacttcatccgtgcagaggaaagaagacatctggcaagatggataggtgtgagtgaagccagagttaagagatggtttaagaagaggagagagcacttcagaagaggacaaagtcagttaggaatgaatgatgacgcctctgtggggtcccactctacctttctctgaagatggcacaggaggcctggtgtaccacccttgaccaggagccacgtgcagacccctgctgccttccaccagcatgttattgcatctctattccctaagcatttgtatgtgaaataaatagattctcagtttctttg
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]