ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-07-04 12:46:54, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS NM_001426402 1699 bp mRNA linear PRI 01-MAY-2025 DEFINITION Homo sapiens claudin 5 (CLDN5), transcript variant 5, mRNA. ACCESSION NM_001426402 VERSION NM_001426402.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1699) AUTHORS Yang,L., Wu,W.J., Lyu,L.C., Tu,Y., Gu,H., Chen,X.F., Chai,Y.J., Man,M.Q. and He,L. TITLE MiRNA-224-5p regulates the defective permeability barrier in sensitive skin by targeting claudin-5 JOURNAL Skin Res Technol 30 (5), e13720 (2024) PUBMED 38743384 REMARK GeneRIF: MiRNA-224-5p regulates the defective permeability barrier in sensitive skin by targeting claudin-5. REFERENCE 2 (bases 1 to 1699) AUTHORS Tachibana,K., Hirayama,R., Sato,N., Hattori,K., Kato,T., Takeda,H. and Kondoh,M. TITLE Association of Plasma Claudin-5 with Age and Alzheimer Disease JOURNAL Int J Mol Sci 25 (3), 1419 (2024) PUBMED 38338697 REMARK GeneRIF: Association of Plasma Claudin-5 with Age and Alzheimer Disease. Publication Status: Online-Only REFERENCE 3 (bases 1 to 1699) AUTHORS Huang,S., Zhang,J., Li,Y., Xu,Y., Jia,H., An,L., Wang,X. and Yang,Y. TITLE Downregulation of Claudin5 promotes malignant progression and radioresistance through Beclin1-mediated autophagy in esophageal squamous cell carcinoma JOURNAL J Transl Med 21 (1), 379 (2023) PUBMED 37303041 REMARK GeneRIF: Downregulation of Claudin5 promotes malignant progression and radioresistance through Beclin1-mediated autophagy in esophageal squamous cell carcinoma. Publication Status: Online-Only REFERENCE 4 (bases 1 to 1699) AUTHORS Boncuk Ulas,S., Guzey Aras,Y., Irmak Gozukara,S., Acar,T. and Acar,B.A. TITLE Correlates of Zonulin and Claudin-5, markers of intestinal and brain endothelial permeability, in Parkinson's Disease: A pilot study JOURNAL Parkinsonism Relat Disord 110, 105361 (2023) PUBMED 36963340 REMARK GeneRIF: Correlates of Zonulin and Claudin-5, markers of intestinal and brain endothelial permeability, in Parkinson's Disease: A pilot study. REFERENCE 5 (bases 1 to 1699) AUTHORS Hashimoto,Y., Greene,C., Munnich,A. and Campbell,M. TITLE The CLDN5 gene at the blood-brain barrier in health and disease JOURNAL Fluids Barriers CNS 20 (1), 22 (2023) PUBMED 36978081 REMARK GeneRIF: The CLDN5 gene at the blood-brain barrier in health and disease. Review article Publication Status: Online-Only REFERENCE 6 (bases 1 to 1699) AUTHORS Kniesel,U. and Wolburg,H. TITLE Tight junctions of the blood-brain barrier JOURNAL Cell Mol Neurobiol 20 (1), 57-76 (2000) PUBMED 10690502 REMARK Review article REFERENCE 7 (bases 1 to 1699) AUTHORS Itoh,M., Furuse,M., Morita,K., Kubota,K., Saitou,M. and Tsukita,S. TITLE Direct binding of three tight junction-associated MAGUKs, ZO-1, ZO-2, and ZO-3, with the COOH termini of claudins JOURNAL J Cell Biol 147 (6), 1351-1363 (1999) PUBMED 10601346 REFERENCE 8 (bases 1 to 1699) AUTHORS Morita,K., Furuse,M., Fujimoto,K. and Tsukita,S. TITLE Claudin multigene family encoding four-transmembrane domain protein components of tight junction strands JOURNAL Proc Natl Acad Sci U S A 96 (2), 511-516 (1999) PUBMED 9892664 REFERENCE 9 (bases 1 to 1699) AUTHORS Peacock,R.E., Keen,T.J. and Inglehearn,C.F. TITLE Analysis of a human gene homologous to rat ventral prostate.1 protein JOURNAL Genomics 46 (3), 443-449 (1997) PUBMED 9441748 REFERENCE 10 (bases 1 to 1699) AUTHORS Sirotkin,H., Morrow,B., Saint-Jore,B., Puech,A., Das Gupta,R., Patanjali,S.R., Skoultchi,A., Weissman,S.M. and Kucherlapati,R. TITLE Identification, characterization, and precise mapping of a human gene encoding a novel membrane-spanning protein from the 22q11 region deleted in velo-cardio-facial syndrome JOURNAL Genomics 42 (2), 245-251 (1997) PUBMED 9192844 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from CP068256.2. Summary: This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Mutations in this gene have been found in patients with velocardiofacial syndrome. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, May 2018]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: SRR3476690.792681.1, DB023636.1 [ECO:0000332] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-183 CP068256.2 19901996-19902178 c 184-1699 CP068256.2 19899868-19901383 c FEATURES Location/Qualifiers source 1..1699 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="22" /map="22q11.21" gene 1..1699 /gene="CLDN5" /gene_synonym="AWAL; BEC1; CPETRL1; TMDVCF; TMVCF" /note="claudin 5" /db_xref="GeneID:7122" /db_xref="HGNC:HGNC:2047" /db_xref="MIM:602101" exon 1..183 /gene="CLDN5" /gene_synonym="AWAL; BEC1; CPETRL1; TMDVCF; TMVCF" /inference="alignment:Splign:2.1.0" exon 184..1699 /gene="CLDN5" /gene_synonym="AWAL; BEC1; CPETRL1; TMDVCF; TMVCF" /inference="alignment:Splign:2.1.0" misc_feature 324..326 /gene="CLDN5" /gene_synonym="AWAL; BEC1; CPETRL1; TMDVCF; TMVCF" /note="upstream in-frame stop codon" CDS 471..1127 /gene="CLDN5" /gene_synonym="AWAL; BEC1; CPETRL1; TMDVCF; TMVCF" /note="isoform 2 is encoded by transcript variant 5; transmembrane protein deleted in velocardiofacial syndrome; transmembrane protein deleted in VCFS" /codon_start=1 /product="claudin-5 isoform 2" /protein_id="NP_001413331.1" /db_xref="GeneID:7122" /db_xref="HGNC:HGNC:2047" /db_xref="MIM:602101" /translation="
MGSAALEILGLVLCLVGWGGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSTEVQAARALTVSAVLLAFVALFVTLAGAQCTTCVAPGPAKARVALTGGVLYLFCGLLALVPLCWFANIVVREFYDPSVPVSQKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKNYV"
misc_feature 483..1013
/gene="CLDN5"
/gene_synonym="AWAL; BEC1; CPETRL1; TMDVCF; TMVCF"
/note="PMP-22/EMP/MP20/Claudin family; Region:
PMP22_Claudin; cl21598"
/db_xref="CDD:473919"
misc_feature 492..554
/gene="CLDN5"
/gene_synonym="AWAL; BEC1; CPETRL1; TMDVCF; TMVCF"
/note="propagated from UniProtKB/Swiss-Prot (O00501.1);
transmembrane region"
misc_feature 714..776
/gene="CLDN5"
/gene_synonym="AWAL; BEC1; CPETRL1; TMDVCF; TMVCF"
/note="propagated from UniProtKB/Swiss-Prot (O00501.1);
transmembrane region"
misc_feature 837..899
/gene="CLDN5"
/gene_synonym="AWAL; BEC1; CPETRL1; TMDVCF; TMVCF"
/note="propagated from UniProtKB/Swiss-Prot (O00501.1);
transmembrane region"
misc_feature 948..1010
/gene="CLDN5"
/gene_synonym="AWAL; BEC1; CPETRL1; TMDVCF; TMVCF"
/note="propagated from UniProtKB/Swiss-Prot (O00501.1);
transmembrane region"
misc_feature 1119..1124
/gene="CLDN5"
/gene_synonym="AWAL; BEC1; CPETRL1; TMDVCF; TMVCF"
/note="propagated from UniProtKB/Swiss-Prot (O00501.1);
Region: Interactions with TJP1, TJP2 and TJP3.
/evidence=ECO:0000250"
regulatory 1680..1685
/regulatory_class="polyA_signal_sequence"
/gene="CLDN5"
/gene_synonym="AWAL; BEC1; CPETRL1; TMDVCF; TMVCF"
/note="hexamer: AGTAAA"
polyA_site 1699
/gene="CLDN5"
/gene_synonym="AWAL; BEC1; CPETRL1; TMDVCF; TMVCF"
/note="major polyA site"
ORIGIN
gtctctcctgtctgaaggccagagcaggctgctaggcctggggccaccactgcccctgggtgctacacccagtgtgctgggtcactgggaacttcctgaagtggtgtcacctgaactgggcccccaaggatggggtgcgggcagtaccgcaggaagaggagcagcccctgtgaagattgagagctgccagaggctctgtgattggctgcggcacgatgacccgcgcacggattggctgcttcgggccggggggccgggcccgggggacagaatccgcccccgaaccttcaaagagggtaccccccggcaggagctggcagacctaggaggtgcgacagacccgcggggcaaacggactggggccaagagccgggagcgcgggcgcaaaggcaccagggcccgcccagggcgccgcgcagcacggccttgggggttctgcgggccttcgggtgcgcgtctcgcctctagccatggggtccgcagcgttggagatcctgggcctggtgctgtgcctggtgggctgggggggtctgatcctggcgtgcgggctgcccatgtggcaggtgaccgccttcctggaccacaacatcgtgacggcgcagaccacctggaaggggctgtggatgtcgtgcgtggtgcagagcaccgggcacatgcagtgcaaagtgtacgactcggtgctggctctgagcaccgaggtgcaggcggcgcgggcgctcaccgtgagcgccgtgctgctggcgttcgttgcgctcttcgtgaccctggcgggcgcgcagtgcaccacctgcgtggccccgggcccggccaaggcgcgtgtggccctcacgggaggcgtgctctacctgttttgcgggctgctggcgctcgtgccactctgctggttcgccaacattgtcgtccgcgagttttacgacccgtctgtgcccgtgtcgcagaagtacgagctgggcgcagcgctgtacatcggctgggcggccaccgcgctgctcatggtaggcggctgcctcttgtgctgcggcgcctgggtctgcaccggccgtcccgacctcagcttccccgtgaagtactcagcgccgcggcggcccacggccaccggcgactacgacaagaagaactacgtctgagggcgctgggcacggccgggcccctcctgccagccacgcctgcgaggcgttggataagcctggggagccccgcatggaccgcggcttccgccgggtagcgcggcgcgcaggctcctcggaacgtccggctctgcgccccgacgcggctcctggatccgctcctgcctgcgcccgcagctgaccttctcctgccactagcccggccctgcccttaacagacggaatgaagtttccttttctgtgcgcggcgctgtttccataggcagagcgggtgtcagactgaggatttcgcttcccctccaagacgctgggggtcttggctgctgccttacttcccagaggctcctgctgacttcggaggggcggatgcagagcccagggcccccaccggaagatgtgtacagctggtctttactccatcggcagggcccgagcccagggaccagtgacttggcctggacctcccggtctcactccagcatctccccaggcaaggcttgtgggcaccggagcttgagagagggcgggagtgggaaggctaagaatctgcttagtaaatggtttgaactctc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]