GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-05-11 03:28:37, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001414464            2994 bp    mRNA    linear   PRI 21-FEB-2023
DEFINITION  Homo sapiens transmembrane BAX inhibitor motif containing 6
            (TMBIM6), transcript variant 5, mRNA.
ACCESSION   NM_001414464 XM_024449173
VERSION     NM_001414464.1
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2994)
  AUTHORS   Zhang X, Chen Q, He Y, Shi Q, Yin C, Xie Y, Yu H, Bao Y, Wang X,
            Tang C and Dong Z.
  TITLE     STRIP2 motivates non-small cell lung cancer progression by
            modulating the TMBIM6 stability through IGF2BP3 dependent
  JOURNAL   J Exp Clin Cancer Res 42 (1), 19 (2023)
   PUBMED   36639675
  REMARK    GeneRIF: STRIP2 motivates non-small cell lung cancer progression by
            modulating the TMBIM6 stability through IGF2BP3 dependent.
            Publication Status: Online-Only
REFERENCE   2  (bases 1 to 2994)
  AUTHORS   Liao Y, Qiu Z and Bai L.
  TITLE     miR-302d-3p regulates the viability, migration and apoptosis of
            breast cancer cells through regulating the TMBIM6-mediated ERK
            signaling pathway
  JOURNAL   Mol Med Rep 24 (6) (2021)
   PUBMED   34651659
  REMARK    GeneRIF: miR302d3p regulates the viability, migration and apoptosis
            of breast cancer cells through regulating the TMBIM6mediated ERK
            signaling pathway.
REFERENCE   3  (bases 1 to 2994)
  AUTHORS   Bhattarai KR, Kim HK, Chaudhary M, Ur Rashid MM, Kim J, Kim HR and
            Chae HJ.
  TITLE     TMBIM6 regulates redox-associated posttranslational modifications
            of IRE1alpha and ER stress response failure in aging mice and
            humans
  JOURNAL   Redox Biol 47, 102128 (2021)
   PUBMED   34562874
  REMARK    GeneRIF: TMBIM6 regulates redox-associated posttranslational
            modifications of IRE1alpha and ER stress response failure in aging
            mice and humans.
REFERENCE   4  (bases 1 to 2994)
  AUTHORS   Chang X, Zhang T, Meng Q, ShiyuanWang, Yan P, Wang X, Luo D, Zhou X
            and Ji R.
  TITLE     Quercetin Improves Cardiomyocyte Vulnerability to Hypoxia by
            Regulating SIRT1/TMBIM6-Related Mitophagy and Endoplasmic Reticulum
            Stress
  JOURNAL   Oxid Med Cell Longev 2021, 5529913 (2021)
   PUBMED   33859776
  REMARK    GeneRIF: Quercetin Improves Cardiomyocyte Vulnerability to Hypoxia
            by Regulating SIRT1/TMBIM6-Related Mitophagy and Endoplasmic
            Reticulum Stress.
            Publication Status: Online-Only
REFERENCE   5  (bases 1 to 2994)
  AUTHORS   Han Q, Wang J, Luo H, Li L, Lu X, Liu A, Deng Y and Jiang Y.
  TITLE     TMBIM6, a potential virus target protein identified by integrated
            multiomics data analysis in SARS-CoV-2-infected host cells
  JOURNAL   Aging (Albany NY) 13 (7), 9160-9185 (2021)
   PUBMED   33744846
  REMARK    GeneRIF: TMBIM6, a potential virus target protein identified by
            integrated multiomics data analysis in SARS-CoV-2-infected host
            cells.
REFERENCE   6  (bases 1 to 2994)
  AUTHORS   Grzmil M, Thelen P, Hemmerlein B, Schweyer S, Voigt S, Mury D and
            Burfeind P.
  TITLE     Bax inhibitor-1 is overexpressed in prostate cancer and its
            specific down-regulation by RNA interference leads to cell death in
            human prostate carcinoma cells
  JOURNAL   Am J Pathol 163 (2), 543-552 (2003)
   PUBMED   12875974
  REMARK    GeneRIF: Results indicate that the human Bax inhibitor-1 gene may
            serve as a prostate cancer expression marker based on its
            overexpression in prostate carcinoma and prostate cancer cell
            lines.
REFERENCE   7  (bases 1 to 2994)
  AUTHORS   Jean JC, Oakes SM and Joyce-Brady M.
  TITLE     The Bax inhibitor-1 gene is differentially regulated in adult
            testis and developing lung by two alternative TATA-less promoters
  JOURNAL   Genomics 57 (2), 201-208 (1999)
   PUBMED   10198159
REFERENCE   8  (bases 1 to 2994)
  AUTHORS   Cowling RT and Birnboim HC.
  TITLE     Preliminary characterization of the protein encoded by human
            testis-enhanced gene transcript (TEGT)
  JOURNAL   Mol Membr Biol 15 (4), 177-187 (1998)
   PUBMED   10087504
REFERENCE   9  (bases 1 to 2994)
  AUTHORS   Xu Q and Reed JC.
  TITLE     Bax inhibitor-1, a mammalian apoptosis suppressor identified by
            functional screening in yeast
  JOURNAL   Mol Cell 1 (3), 337-346 (1998)
   PUBMED   9660918
REFERENCE   10 (bases 1 to 2994)
  AUTHORS   Walter L, Marynen P, Szpirer J, Levan G and Gunther E.
  TITLE     Identification of a novel conserved human gene, TEGT
  JOURNAL   Genomics 28 (2), 301-304 (1995)
   PUBMED   8530040
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AC084037.35 and AC131157.4.
            
            On Feb 21, 2023 this sequence version replaced XM_024449173.2.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: SRR14038193.2480422.1,
                                           SRR14038192.1888115.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA1965299, SAMEA1968540
                                           [ECO:0000348]
            ##Evidence-Data-END##
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-212               AC084037.35        28819-29030
            213-298             AC084037.35        39726-39811
            299-407             AC084037.35        40235-40343
            408-528             AC084037.35        42897-43017
            529-577             AC084037.35        45489-45537
            578-675             AC084037.35        45645-45742
            676-755             AC084037.35        45945-46024
            756-856             AC084037.35        46483-46583
            857-932             AC131157.4         3177-3252
            933-2994            AC131157.4         4346-6407
FEATURES             Location/Qualifiers
     source          1..2994
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="12"
                     /map="12q13.12"
     gene            1..2994
                     /gene="TMBIM6"
                     /gene_synonym="BAXI1; BI-1; TEGT"
                     /note="transmembrane BAX inhibitor motif containing 6"
                     /db_xref="GeneID:7009"
                     /db_xref="HGNC:HGNC:11723"
                     /db_xref="MIM:600748"
     exon            1..212
                     /gene="TMBIM6"
                     /gene_synonym="BAXI1; BI-1; TEGT"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    168..170
                     /gene="TMBIM6"
                     /gene_synonym="BAXI1; BI-1; TEGT"
                     /note="upstream in-frame stop codon"
     exon            213..298
                     /gene="TMBIM6"
                     /gene_synonym="BAXI1; BI-1; TEGT"
                     /inference="alignment:Splign:2.1.0"
     CDS             243..956
                     /gene="TMBIM6"
                     /gene_synonym="BAXI1; BI-1; TEGT"
                     /note="isoform 1 is encoded by transcript variant 5; BAX
                     inhibitor 1; testis-enhanced gene transcript protein;
                     transmembrane BAX inhibitor motif-containing protein 6;
                     testis enhanced gene transcript"
                     /codon_start=1
                     /product="bax inhibitor 1 isoform 1"
                     /protein_id="NP_001401393.1"
                     /db_xref="GeneID:7009"
                     /db_xref="HGNC:HGNC:11723"
                     /db_xref="MIM:600748"
                     /translation="
MNIFDRKINFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHMVTHFIQAGLLSALGSLILMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALEFCIAVNPSILPTAFMGTAMIFTCFTLSALYARRRSYLFLGGILMSALSLLLLSSLGNVFFGSIWLFQANLYVGLVVMCGFVLFDTQLIIEKAEHGDQDYIWHCIDLFLDFITVFRKLMMILAMNEKDKKKEKK"
     misc_feature    288..926
                     /gene="TMBIM6"
                     /gene_synonym="BAXI1; BI-1; TEGT"
                     /note="BAX inhibitor (BI)-1; Region: BI-1; cd10430"
                     /db_xref="CDD:198412"
     misc_feature    330..392
                     /gene="TMBIM6"
                     /gene_synonym="BAXI1; BI-1; TEGT"
                     /note="propagated from UniProtKB/Swiss-Prot (P55061.2);
                     transmembrane region"
     misc_feature    399..461
                     /gene="TMBIM6"
                     /gene_synonym="BAXI1; BI-1; TEGT"
                     /note="propagated from UniProtKB/Swiss-Prot (P55061.2);
                     transmembrane region"
     misc_feature    501..563
                     /gene="TMBIM6"
                     /gene_synonym="BAXI1; BI-1; TEGT"
                     /note="propagated from UniProtKB/Swiss-Prot (P55061.2);
                     transmembrane region"
     misc_feature    579..641
                     /gene="TMBIM6"
                     /gene_synonym="BAXI1; BI-1; TEGT"
                     /note="propagated from UniProtKB/Swiss-Prot (P55061.2);
                     transmembrane region"
     misc_feature    660..722
                     /gene="TMBIM6"
                     /gene_synonym="BAXI1; BI-1; TEGT"
                     /note="propagated from UniProtKB/Swiss-Prot (P55061.2);
                     transmembrane region"
     misc_feature    741..803
                     /gene="TMBIM6"
                     /gene_synonym="BAXI1; BI-1; TEGT"
                     /note="propagated from UniProtKB/Swiss-Prot (P55061.2);
                     transmembrane region"
     exon            299..407
                     /gene="TMBIM6"
                     /gene_synonym="BAXI1; BI-1; TEGT"
                     /inference="alignment:Splign:2.1.0"
     exon            408..528
                     /gene="TMBIM6"
                     /gene_synonym="BAXI1; BI-1; TEGT"
                     /inference="alignment:Splign:2.1.0"
     exon            529..577
                     /gene="TMBIM6"
                     /gene_synonym="BAXI1; BI-1; TEGT"
                     /inference="alignment:Splign:2.1.0"
     exon            578..675
                     /gene="TMBIM6"
                     /gene_synonym="BAXI1; BI-1; TEGT"
                     /inference="alignment:Splign:2.1.0"
     exon            676..755
                     /gene="TMBIM6"
                     /gene_synonym="BAXI1; BI-1; TEGT"
                     /inference="alignment:Splign:2.1.0"
     exon            756..856
                     /gene="TMBIM6"
                     /gene_synonym="BAXI1; BI-1; TEGT"
                     /inference="alignment:Splign:2.1.0"
     exon            857..932
                     /gene="TMBIM6"
                     /gene_synonym="BAXI1; BI-1; TEGT"
                     /inference="alignment:Splign:2.1.0"
     exon            933..2994
                     /gene="TMBIM6"
                     /gene_synonym="BAXI1; BI-1; TEGT"
                     /inference="alignment:Splign:2.1.0"
     regulatory      1047..1052
                     /regulatory_class="polyA_signal_sequence"
                     /gene="TMBIM6"
                     /gene_synonym="BAXI1; BI-1; TEGT"
                     /note="hexamer: AATGAA"
     polyA_site      1065
                     /gene="TMBIM6"
                     /gene_synonym="BAXI1; BI-1; TEGT"
                     /note="major polyA site"
     regulatory      2936..2941
                     /regulatory_class="polyA_signal_sequence"
                     /gene="TMBIM6"
                     /gene_synonym="BAXI1; BI-1; TEGT"
                     /note="hexamer: AATATA"
     regulatory      2971..2976
                     /regulatory_class="polyA_signal_sequence"
                     /gene="TMBIM6"
                     /gene_synonym="BAXI1; BI-1; TEGT"
                     /note="hexamer: AATAAA"
     polyA_site      2972
                     /gene="TMBIM6"
                     /gene_synonym="BAXI1; BI-1; TEGT"
                     /note="major polyA site"
     polyA_site      2994
                     /gene="TMBIM6"
                     /gene_synonym="BAXI1; BI-1; TEGT"
                     /note="major polyA site"
ORIGIN      
agagcacatccggtgttagaagcgctggtaggccttggagaggcgggttaggaaggtacgtctgaacctagtactgggcgaactgggagtgagaaatggaaagggagttagcagttactgtctgagcaagagtggcagtagcttccttctgcggacagatggcaccctgaaggaacgaggccctgctcggagaccagactcgggaaaacaggagtggagactgctgcacggactctggaaccatgaacatatttgatcgaaagatcaactttgatgcgcttttaaaattttctcatataaccccgtcaacgcagcagcacctgaagaaggtctatgcaagttttgccctttgtatgtttgtggcggctgcaggggcctatgtccatatggtcactcatttcattcaggctggcctgctgtctgccttgggctccctgatattgatgatttggctgatggcaacacctcatagccatgaaactgaacagaaaagactgggacttcttgctggatttgcattccttacaggagttggcctgggccctgccctggagttttgtattgctgtcaaccccagcatccttcccactgctttcatgggcacggcaatgatctttacctgcttcaccctcagtgcactctatgccaggcgccgtagctacctctttctgggaggtatcttgatgtcagccctgagcttgttgcttttgtcttccctggggaatgttttctttggatccatttggcttttccaggcaaacctgtatgtgggactggtggtcatgtgtggcttcgtcctttttgatactcaactcattattgaaaaggccgaacatggagatcaagattatatctggcactgcattgatctcttcttagatttcattactgtcttcagaaaactcatgatgatcctggccatgaatgaaaaggataagaagaaagagaagaaatgaagtgaccatccagcctttcccaattagacttcctctccttccacccctcatttcctttttgcacacattacaggtggtgtgttctgtgataatgaaaagcatcagaaaagcttttgtactttgtggtttcctctattttgaattttttgatcaaaaaactgattagcagaatatagtttggagtttggcttcatcttcctggggttcccctcactcccttttttgtcaaccccatctgtagcctcttcctctactcaggcagtcgacccgccacgatgagaagtgggaccagcagagggcgccaacttcaggagtccgctttcccaccaggcttcattcacccagtggacctgaactgtttggtagagccacccggcccttccttcctcattgttgtttggtatgcgcacagttcctgtgggactgggccgtgagttttccattggaaagaagttcagtggtcccattgttaactcagcctcaaatctcaactgtcaggccctacaaagaaaatggagagcctcttctggtggatgctttgctccctctgagctgcccatgctggtctggcaaacacacctttctgctttgccttcacaaaagtaatgtgttccctttcccaccccttgcctgaccctcagggagtcagcctgcttccatccatgggtgggaagacttcagcacaaaggaaagactaattcttgtcaggcatttttgaaaaggctgattatgtgtatcaaggtacagcatcgtagggttcccctaaacttgccctgtttttgtttttttagtttgttatccccttactgagcggcctctactaggtggctgtgattaaatgtcccaagcaaggatagggaaggggaatggttgagcctctggagatcattgtaaccaatcctgccagacctgtttggggcagtggggagcaaacctagataaggacctgtttggggcagcagggagcaaaatctcctttaacaaccaagcagttcctcattcacatcaacagagcgaggctgtgataacttaggaggcagcaatcctaatagtccttcagtgcattttagtctgtctccaactggacaccagtaggtagtgtcaagccagagattcggggcagtagataaatgttcattttactgatgcactttagtttttggtctgttacctgttttccagaaatttgtggccttttaggcgggagttaggcgaccaaaccagtgagagccccaatccctgcagttttgtggcttcaagtgtgggtggacagtcctaatggggatctccagctccttcctgtgggctgccacagacagctacccccagaagggtcaatgttgggagtggttgtggctctgagctgctctacagagcttcagtgtgagaggatcgagccattgaaagctcattaccagtaggacataatttttggctctccctattcacaaccagtgcacagtttgacacagtggcctcaggttcacagtgcaccatgtcactgtgctatcctacgaaatcatttgtttctaagttgtgtttattcctggagtgacatgccaccccgaatggctcactttcactgaggatgctgtcctctgatttagctgctgcctccagcctctggcttgagaacttactaaaggcacttccttcctgttaaacccctgttaactctccataaatttggtgattctctgctaggcctaagattttgagttaacatctcttgaagccaaactccaccttctgtgctttttgcttgggataatggagtttttctttagaaacagtgccaagaatgacaagatattaaaaaaaaaaaagaaagaaaaaaaaaaaaacacctacttttaaagaaaatacctaacagatttttaatatagttatctctaccactttcttttctagtttcttgattttcagctcaggctgcattctaactcatactgtgaagacaaaggtgtttttgattcagaaatatatgaaatctgcatagtcttaatttgtaaaaaataaagaaaattccttaaccttt
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]