GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-07-15 20:30:08, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       XM_054373236            2656 bp    mRNA    linear   PRI 26-AUG-2024
DEFINITION  PREDICTED: Homo sapiens acyl-CoA synthetase short chain family
            member 3 (ACSS3), transcript variant X5, mRNA.
ACCESSION   XM_054373236
VERSION     XM_054373236.1
DBLINK      BioProject: PRJNA807723
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_060936) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Updated annotation
            Annotation Name             :: GCF_009914755.1-RS_2024_08
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           RefSeqFE; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 08/23/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2656
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /isolate="CHM13"
                     /db_xref="taxon:9606"
                     /chromosome="12"
                     /sex="female"
                     /cell_line="CHM13htert"
                     /tissue_type="hydatidiform mole"
                     /note="haploid cell line"
     gene            1..2656
                     /gene="ACSS3"
                     /note="acyl-CoA synthetase short chain family member 3;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 17 ESTs, 84 long SRA reads, and 89%
                     coverage of the annotated genomic feature by RNAseq
                     alignments, including 49 samples with support for all
                     annotated introns"
                     /db_xref="GeneID:79611"
                     /db_xref="HGNC:HGNC:24723"
                     /db_xref="MIM:614356"
     CDS             43..1410
                     /gene="ACSS3"
                     /codon_start=1
                     /product="acyl-CoA synthetase short-chain family member 3,
                     mitochondrial isoform X2"
                     /protein_id="XP_054229211.1"
                     /db_xref="GeneID:79611"
                     /db_xref="HGNC:HGNC:24723"
                     /db_xref="MIM:614356"
                     /translation="
MKPSWLQCRKVTSAGGLGGPLPGSSPARGAGAALRALVVPGPRGGLGGRGCRALSSGSGSEYKTHFAASVTDPERFWGKAAEQISWYKPWTKTLENKHSPSTRWFVEGMLNICYNAVDRHIENGKGDKIAIIYDSPVTNTKATFTYKEVLEQVSKLAGVLVKHGIKKGDTVVIYMPMIPQAMYTMLACARIGAIHSLIFGGFASKELSSRIDHVKPKVVVTASFGIEPGRRVEYVPLVEEALKIGQHKPDKILIYNRPNMEAVPLAPGRDLDWDEEMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVIRPTGGYAVMLHWSMSSIYGLQPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVAGERCDVETLEWSKNVFRVPVLDHWWQTGIKH"
     misc_feature    226..>1395
                     /gene="ACSS3"
                     /note="This family includes acyl- and aryl-CoA ligases, as
                     well as the adenylation domain of nonribosomal peptide
                     synthetases and firefly luciferases. The adenylate-forming
                     enzymes catalyze an ATP-dependent two-step reaction to
                     first activate a carboxylate...; Region: Adenylate forming
                     domain, Class I superfamily; cl17068"
                     /db_xref="CDD:473059"
     misc_feature    order(928..930,937..954,958..963)
                     /gene="ACSS3"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:341271"
ORIGIN      
accatttgtcgcacactcggggaccgcgggtggccggaggagatgaaaccgtcttggctgcagtgtcgtaaagtcaccagcgccggggggctcggagggcccttgcctgggtcctctccggcccggggagccggtgcggccctcagggctttagtggtcccgggcccgcggggcggtctcgggggccggggatgcagggcactgtcctccggcagtggcagcgagtacaagacccacttcgcagcctcggtgaccgaccccgagaggttctggggcaaagctgccgagcagatcagctggtacaagccctggaccaaaacgctggagaacaaacactcgccctctaccaggtggtttgtggaaggaatgcttaacatttgttacaatgccgttgatcgtcatattgaaaatggtaaaggggataagattgctatcatctatgacagtcctgttacaaacactaaagcaacctttacctataaagaagttctggagcaggtctccaagctggctggtgtcttggtcaagcatggcatcaagaaaggtgacactgtggttatctacatgcctatgatcccacaggcgatgtataccatgttggcatgtgcaaggataggtgccatccacagtctcatatttggaggatttgcttccaaagaactaagtagtcgcattgatcatgtaaagcccaaggtggttgttacagcatcatttggcattgaacctggaaggagggtagagtacgtaccacttgtagaagaagcgctaaaaataggacaacacaaaccagacaaaattctcatttataatcgtccaaatatggaggcggttcctttggctcccggtcgtgaccttgattgggatgaagagatggcaaaagcccagtcacatgactgtgttcctgttctttcagaacacccactgtatattctttacacatctggcacaacggggttacctaagggtgtgattaggcccactgggggatacgctgtcatgctacactggtcaatgtcttccatatacggacttcaacccggagaggtgtggtgggcagcttctgacttaggctgggttgttggacattcctatatctgctatggacctcttcttcatgggaacacaacagttttatatgaggggaagcctgtgggaacaccagatgctggcgcttatttccgtgtgcttgcagagcatggagtagctgccttgtttacagcaccaactgcaattagagcaatccgtcaacaggaccctggggcagctttggggaagcagtactctctgacaaggttcaaaacattatttgtggctggagaacgatgtgatgtagagaccctggaatggtccaaaaatgtcttcagagtacctgtcttagaccattggtggcaaactggtataaagcactaaagacctctttatcttctcttctttgtttcttatatctggtaagttactaagtctcagattttcctttgaagtgtctgttgggttcattccaccttcagtattccccttgcctttgagctctggcagctgcattatcctctgtcctgatttaaagtttcctaatcactcatctctattctctctgctttttgatacacactgcacactgctcccagagtccttttatgaaggcttgttcctctcataggactctctggccaccttcttgtgttctataatatctaatatattctgcctagcattaaaggcagagaaatttatttttcttcaaaacaattgtcattacatatgtaatttgttcatttaatttattttgtttattccctatagtcctccctctaagtgttccctgggaaacaaattttcatattaaatggatcaactataaactttggaataagcagacaaccaccacaacaataactctatctgctgcttcttttgagggatggctatatatatgagaatgggtacattgtctagaagccatttacctcctcacaaagtacagagattttaaaaaatttgactcactgaaagcagctatgagccatgggagccctacaacctttatatgtacatattttattttagtcccacttagttcaatgaattagatcaacctttttatatacatattttcagtattctcaccttctctgcatctggggcagaatatcaaatttgggttaaaaattagtgagattactttgcaaaaaattagctctgattgtaaaaatgattttcatgtaaaagattaactgaatgactaagcctgaaatgcagtgtttgatacttcagaagtttctgattctgacaaattatactttttatattatgtccttgaatattgttctttaaaaatgtgttttctgactgggcacggtggctcatgcctataattcctgcactttgggaagcaaaaacaggcagatcacttgagatcacttgaggtcaggagttacagaccagcctggccaacatggtgaaaccccatctctacttaaaatacaaaaaattagccaggcgtgatggagcgtgcctgtaatctcagctactcgggaggcagagaattgcttgaacccaggaggaggaggttgcggtgagccaagatcctatcattgcactccagcctgggcaacagagcaagactgtcaaaaaaaaaaaaaaaaagaaaaagaaagaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]