2025-07-15 20:30:08, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_054373236 2656 bp mRNA linear PRI 26-AUG-2024 DEFINITION PREDICTED: Homo sapiens acyl-CoA synthetase short chain family member 3 (ACSS3), transcript variant X5, mRNA. ACCESSION XM_054373236 VERSION XM_054373236.1 DBLINK BioProject: PRJNA807723 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_060936) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Updated annotation Annotation Name :: GCF_009914755.1-RS_2024_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Best-placed RefSeq; Gnomon; RefSeqFE; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/23/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..2656 /organism="Homo sapiens" /mol_type="mRNA" /isolate="CHM13" /db_xref="taxon:9606" /chromosome="12" /sex="female" /cell_line="CHM13htert" /tissue_type="hydatidiform mole" /note="haploid cell line" gene 1..2656 /gene="ACSS3" /note="acyl-CoA synthetase short chain family member 3; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 17 ESTs, 84 long SRA reads, and 89% coverage of the annotated genomic feature by RNAseq alignments, including 49 samples with support for all annotated introns" /db_xref="GeneID:79611" /db_xref="HGNC:HGNC:24723" /db_xref="MIM:614356" CDS 43..1410 /gene="ACSS3" /codon_start=1 /product="acyl-CoA synthetase short-chain family member 3, mitochondrial isoform X2" /protein_id="XP_054229211.1" /db_xref="GeneID:79611" /db_xref="HGNC:HGNC:24723" /db_xref="MIM:614356" /translation="
MKPSWLQCRKVTSAGGLGGPLPGSSPARGAGAALRALVVPGPRGGLGGRGCRALSSGSGSEYKTHFAASVTDPERFWGKAAEQISWYKPWTKTLENKHSPSTRWFVEGMLNICYNAVDRHIENGKGDKIAIIYDSPVTNTKATFTYKEVLEQVSKLAGVLVKHGIKKGDTVVIYMPMIPQAMYTMLACARIGAIHSLIFGGFASKELSSRIDHVKPKVVVTASFGIEPGRRVEYVPLVEEALKIGQHKPDKILIYNRPNMEAVPLAPGRDLDWDEEMAKAQSHDCVPVLSEHPLYILYTSGTTGLPKGVIRPTGGYAVMLHWSMSSIYGLQPGEVWWAASDLGWVVGHSYICYGPLLHGNTTVLYEGKPVGTPDAGAYFRVLAEHGVAALFTAPTAIRAIRQQDPGAALGKQYSLTRFKTLFVAGERCDVETLEWSKNVFRVPVLDHWWQTGIKH"
misc_feature 226..>1395 /gene="ACSS3" /note="This family includes acyl- and aryl-CoA ligases, as well as the adenylation domain of nonribosomal peptide synthetases and firefly luciferases. The adenylate-forming enzymes catalyze an ATP-dependent two-step reaction to first activate a carboxylate...; Region: Adenylate forming domain, Class I superfamily; cl17068" /db_xref="CDD:473059" misc_feature order(928..930,937..954,958..963) /gene="ACSS3" /note="acyl-activating enzyme (AAE) consensus motif; other site" /db_xref="CDD:341271" ORIGIN
accatttgtcgcacactcggggaccgcgggtggccggaggagatgaaaccgtcttggctgcagtgtcgtaaagtcaccagcgccggggggctcggagggcccttgcctgggtcctctccggcccggggagccggtgcggccctcagggctttagtggtcccgggcccgcggggcggtctcgggggccggggatgcagggcactgtcctccggcagtggcagcgagtacaagacccacttcgcagcctcggtgaccgaccccgagaggttctggggcaaagctgccgagcagatcagctggtacaagccctggaccaaaacgctggagaacaaacactcgccctctaccaggtggtttgtggaaggaatgcttaacatttgttacaatgccgttgatcgtcatattgaaaatggtaaaggggataagattgctatcatctatgacagtcctgttacaaacactaaagcaacctttacctataaagaagttctggagcaggtctccaagctggctggtgtcttggtcaagcatggcatcaagaaaggtgacactgtggttatctacatgcctatgatcccacaggcgatgtataccatgttggcatgtgcaaggataggtgccatccacagtctcatatttggaggatttgcttccaaagaactaagtagtcgcattgatcatgtaaagcccaaggtggttgttacagcatcatttggcattgaacctggaaggagggtagagtacgtaccacttgtagaagaagcgctaaaaataggacaacacaaaccagacaaaattctcatttataatcgtccaaatatggaggcggttcctttggctcccggtcgtgaccttgattgggatgaagagatggcaaaagcccagtcacatgactgtgttcctgttctttcagaacacccactgtatattctttacacatctggcacaacggggttacctaagggtgtgattaggcccactgggggatacgctgtcatgctacactggtcaatgtcttccatatacggacttcaacccggagaggtgtggtgggcagcttctgacttaggctgggttgttggacattcctatatctgctatggacctcttcttcatgggaacacaacagttttatatgaggggaagcctgtgggaacaccagatgctggcgcttatttccgtgtgcttgcagagcatggagtagctgccttgtttacagcaccaactgcaattagagcaatccgtcaacaggaccctggggcagctttggggaagcagtactctctgacaaggttcaaaacattatttgtggctggagaacgatgtgatgtagagaccctggaatggtccaaaaatgtcttcagagtacctgtcttagaccattggtggcaaactggtataaagcactaaagacctctttatcttctcttctttgtttcttatatctggtaagttactaagtctcagattttcctttgaagtgtctgttgggttcattccaccttcagtattccccttgcctttgagctctggcagctgcattatcctctgtcctgatttaaagtttcctaatcactcatctctattctctctgctttttgatacacactgcacactgctcccagagtccttttatgaaggcttgttcctctcataggactctctggccaccttcttgtgttctataatatctaatatattctgcctagcattaaaggcagagaaatttatttttcttcaaaacaattgtcattacatatgtaatttgttcatttaatttattttgtttattccctatagtcctccctctaagtgttccctgggaaacaaattttcatattaaatggatcaactataaactttggaataagcagacaaccaccacaacaataactctatctgctgcttcttttgagggatggctatatatatgagaatgggtacattgtctagaagccatttacctcctcacaaagtacagagattttaaaaaatttgactcactgaaagcagctatgagccatgggagccctacaacctttatatgtacatattttattttagtcccacttagttcaatgaattagatcaacctttttatatacatattttcagtattctcaccttctctgcatctggggcagaatatcaaatttgggttaaaaattagtgagattactttgcaaaaaattagctctgattgtaaaaatgattttcatgtaaaagattaactgaatgactaagcctgaaatgcagtgtttgatacttcagaagtttctgattctgacaaattatactttttatattatgtccttgaatattgttctttaaaaatgtgttttctgactgggcacggtggctcatgcctataattcctgcactttgggaagcaaaaacaggcagatcacttgagatcacttgaggtcaggagttacagaccagcctggccaacatggtgaaaccccatctctacttaaaatacaaaaaattagccaggcgtgatggagcgtgcctgtaatctcagctactcgggaggcagagaattgcttgaacccaggaggaggaggttgcggtgagccaagatcctatcattgcactccagcctgggcaacagagcaagactgtcaaaaaaaaaaaaaaaaagaaaaagaaagaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]