GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-26 16:11:02, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_203289               2065 bp    mRNA    linear   PRI 25-DEC-2023
DEFINITION  Homo sapiens POU class 5 homeobox 1 (POU5F1), transcript variant 2,
            mRNA.
ACCESSION   NM_203289
VERSION     NM_203289.6
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2065)
  AUTHORS   Hong L, Hong S and Zhang X.
  TITLE     Expression and Functional Analysis of core stemness factors OSKM
            (OCT4, SOX2, KLF4, and MYC) in Pan-cancer
  JOURNAL   Medicine (Baltimore) 102 (48), e36433 (2023)
   PUBMED   38050242
  REMARK    GeneRIF: Expression and Functional Analysis of core stemness
            factors OSKM (OCT4, SOX2, KLF4, and MYC) in Pan-cancer.
REFERENCE   2  (bases 1 to 2065)
  AUTHORS   Panayiotou T, Eftychiou M, Patera E, Promponas VJ and Strati K.
  TITLE     A paradigm for post-embryonic Oct4 re-expression: E7-induced
            hydroxymethylation regulates Oct4 expression in cervical cancer
  JOURNAL   J Med Virol 95 (12), e29264 (2023)
   PUBMED   38054553
  REMARK    GeneRIF: A paradigm for post-embryonic Oct4 re-expression:
            E7-induced hydroxymethylation regulates Oct4 expression in cervical
            cancer.
REFERENCE   3  (bases 1 to 2065)
  AUTHORS   Wang X and Dai J.
  TITLE     Concise review: isoforms of OCT4 contribute to the confusing
            diversity in stem cell biology
  JOURNAL   Stem Cells 28 (5), 885-893 (2010)
   PUBMED   20333750
  REMARK    GeneRIF: This review article underscores the importance of
            identifying and discriminating the expression and functions of OCT4
            isoforms in stem cell research.
            Review article
REFERENCE   4  (bases 1 to 2065)
  AUTHORS   Zhang W, Wang X, Xiao Z, Liu W, Chen B and Dai J.
  TITLE     Mapping of the minimal internal ribosome entry site element in the
            human embryonic stem cell gene OCT4B mRNA
  JOURNAL   Biochem Biophys Res Commun 394 (3), 750-754 (2010)
   PUBMED   20230781
  REMARK    GeneRIF: a 30-nt sequence (nt 201-231), which is sufficient to
            promote internal initiation of translation of OCT4B mRNA in
            embryonic stem cells was mapped.
REFERENCE   5  (bases 1 to 2065)
  AUTHORS   Wang X, Zhao Y, Xiao Z, Chen B, Wei Z, Wang B, Zhang J, Han J, Gao
            Y, Li L, Zhao H, Zhao W, Lin H and Dai J.
  TITLE     Alternative translation of OCT4 by an internal ribosome entry site
            and its novel function in stress response
  JOURNAL   Stem Cells 27 (6), 1265-1275 (2009)
   PUBMED   19489092
  REMARK    GeneRIF: OCT4 gene, by the regulation of alternative splicing and
            alternative translation initiation, may carry out more crucial
            roles in many biological events.
            GeneRIF: Shows that isoform OCT4B-190 initiates at a non-AUG (CUG)
            translation initiation codon.
REFERENCE   6  (bases 1 to 2065)
  AUTHORS   Atlasi Y, Mowla SJ, Ziaee SA, Gokhale PJ and Andrews PW.
  TITLE     OCT4 spliced variants are differentially expressed in human
            pluripotent and nonpluripotent cells
  JOURNAL   Stem Cells 26 (12), 3068-3074 (2008)
   PUBMED   18787205
  REMARK    GeneRIF: OCT4 spliced variants are differentially expressed in
            human pluripotent and nonpluripotent cells
REFERENCE   7  (bases 1 to 2065)
  AUTHORS   Lee J, Kim HK, Rho JY, Han YM and Kim J.
  TITLE     The human OCT-4 isoforms differ in their ability to confer
            self-renewal
  JOURNAL   J Biol Chem 281 (44), 33554-33565 (2006)
   PUBMED   16951404
  REMARK    GeneRIF: DNA binding, transactivation, and abilities to confer
            self-renewal of the human OCT-4 isoforms differ
REFERENCE   8  (bases 1 to 2065)
  AUTHORS   Wey E, Lyons GE and Schafer BW.
  TITLE     A human POU domain gene, mPOU, is expressed in developing brain and
            specific adult tissues
  JOURNAL   Eur J Biochem 220 (3), 753-762 (1994)
   PUBMED   7908264
REFERENCE   9  (bases 1 to 2065)
  AUTHORS   Takeda J, Seino S and Bell GI.
  TITLE     Human Oct3 gene family: cDNA sequences, alternative splicing, gene
            organization, chromosomal location, and expression at low levels in
            adult tissues
  JOURNAL   Nucleic Acids Res 20 (17), 4613-4620 (1992)
   PUBMED   1408763
REFERENCE   10 (bases 1 to 2065)
  AUTHORS   Schoorlemmer J and Kruijer W.
  TITLE     Octamer-dependent regulation of the kFGF gene in embryonal
            carcinoma and embryonic stem cells
  JOURNAL   Mech Dev 36 (1-2), 75-86 (1991)
   PUBMED   1723621
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from DQ486514.1, DQ486515.1 and
            AI811039.1.
            
            On Aug 13, 2020 this sequence version replaced NM_203289.5.
            
            Summary: This gene encodes a transcription factor containing a POU
            homeodomain that plays a key role in embryonic development and stem
            cell pluripotency. Aberrant expression of this gene in adult
            tissues is associated with tumorigenesis. This gene can participate
            in a translocation with the Ewing's sarcoma gene on chromosome 21,
            which also leads to tumor formation. Alternative splicing, as well
            as usage of alternative AUG and non-AUG translation initiation
            codons, results in multiple isoforms. One of the AUG start codons
            is polymorphic in human populations. Related pseudogenes have been
            identified on chromosomes 1, 3, 8, 10, and 12. [provided by RefSeq,
            Oct 2013].
            
            Transcript Variant: This variant (2, also known as OCT4B) differs
            in the 5' UTR, lacks a portion of the 5' coding region, and
            initiates translation at a downstream in-frame non-AUG (CUG) start
            codon, compared to variant 1. The resulting isoform (2, also known
            as OCT4B-190) is shorter at the N-terminus, compared to isoform 1.
            Variants 2 and 3 encode the same isoform (2). This variant may
            encode additional isoforms through the use of an alternative
            downstream AUG start codon, as well as an alternative upstream AUG
            start codon, which is polymorphic in human populations (AGG allele
            represented in this RefSeq; see rs3130932). Use of alternate start
            codons and the non-AUG start codon is described in PMID:19489092.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: KY781166.1, KX151172.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA1968189, SAMEA1968540
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            non-AUG initiation codon :: PMID: 19489092
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-332               DQ486514.1         1-332
            333-2051            DQ486515.1         1-1719
            2052-2065           AI811039.1         11-24               c
FEATURES             Location/Qualifiers
     source          1..2065
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="6"
                     /map="6p21.33"
     gene            1..2065
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /note="POU class 5 homeobox 1"
                     /db_xref="GeneID:5460"
                     /db_xref="HGNC:HGNC:9221"
                     /db_xref="MIM:164177"
     exon            1..1244
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /inference="alignment:Splign:2.1.0"
     variation       1
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:756575303"
     variation       3..8
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="aaaaa"
                     /replace="aaaaaa"
                     /db_xref="dbSNP:1777333579"
     variation       3
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777333859"
     variation       5
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2151108087"
     variation       15
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:556183524"
     variation       19
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777333028"
     variation       20..21
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:1777332518"
     variation       20
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1230878174"
     variation       22
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1343020362"
     variation       25
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:945378480"
     variation       33
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:915242328"
     variation       35
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1473749165"
     variation       38
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:767061672"
     variation       39
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1244144141"
     variation       41
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1777330580"
     variation       42
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:932840583"
     variation       48
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777330048"
     variation       55
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777329779"
     variation       56
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1323733874"
     variation       59..88
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="caaatagcacttctgtcatgctggatgtca"
                     /replace="caaatagcacttctgtcatgctggatgtcaaatagcacttctgtcatg
                     ctggatgtca"
                     /db_xref="dbSNP:1777326521"
     variation       59
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777329221"
     variation       60
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:3130931"
     variation       61
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2151107929"
     variation       67
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1223033686"
     variation       68
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1054562013"
     variation       70
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1371054306"
     variation       73
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777328204"
     variation       73
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="ggatgaagaacaag"
                     /db_xref="dbSNP:1309830792"
     variation       74..75
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace=""
                     /replace="atgaagaacaagtgccga"
                     /replace="gccga"
                     /db_xref="dbSNP:1409890798"
     variation       74
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1777327959"
     variation       76
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:935889637"
     variation       77
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1308827226"
     variation       79
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777326787"
     variation       90
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1777326233"
     variation       91
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:750002991"
     variation       94
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1777325711"
     variation       95
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777325278"
     variation       101
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:979949563"
     variation       102
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1364491233"
     variation       103
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777324518"
     variation       106
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:573550776"
     variation       107
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2151107769"
     variation       114
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1300756432"
     variation       115
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:76465289"
     variation       120
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777323508"
     variation       125
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1356944417"
     variation       126
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1777322994"
     variation       127
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777322739"
     variation       130
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777322487"
     variation       132
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1229902923"
     variation       135
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:536581051"
     variation       136
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:983180480"
     variation       137
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1454069209"
     variation       139..141
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="aa"
                     /replace="aaa"
                     /db_xref="dbSNP:1777320959"
     variation       142
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1484264122"
     variation       144
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777320435"
     variation       147
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777320187"
     variation       151
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:769146675"
     variation       154
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:977786363"
     variation       156
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1371506489"
     variation       162
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:566021008"
     variation       163
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777318676"
     variation       167
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1582037748"
     variation       171
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1410508850"
     variation       172
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777317928"
     variation       176
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1173026294"
     variation       179
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:749630858"
     variation       189
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1777317122"
     variation       190
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:2151107559"
     variation       191
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1166012936"
     variation       192
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:950476755"
     variation       193
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777316548"
     variation       199
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2151107531"
     variation       201
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1184040360"
     variation       203
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777316008"
     variation       206
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:776087600"
     variation       221
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200340326"
     variation       222..225
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="atga"
                     /replace="atgatga"
                     /db_xref="dbSNP:67207605"
     variation       222
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1185683743"
     variation       223..224
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace=""
                     /replace="aag"
                     /replace="tag"
                     /db_xref="dbSNP:1777314586"
     variation       223
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:77085553"
     variation       224..226
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="gag"
                     /replace="gaggag"
                     /db_xref="dbSNP:9281235"
     variation       224..225
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="ga"
                     /replace="gaaga"
                     /replace="gacga"
                     /db_xref="dbSNP:1777313779"
     variation       224
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="ggag"
                     /replace="gtgg"
                     /db_xref="dbSNP:72545985"
     variation       225..228
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="agta"
                     /replace="agtagta"
                     /db_xref="dbSNP:2151107394"
     variation       225..226
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="ag"
                     /replace="agaag"
                     /db_xref="dbSNP:141270342"
     variation       226..227
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace=""
                     /replace="gat"
                     /db_xref="dbSNP:1777312621"
     variation       226
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="gagg"
                     /db_xref="dbSNP:1554135573"
     variation       227
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:1372634738"
     variation       227
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201576321"
     variation       227
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:1777312105"
     variation       228..229
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace=""
                     /replace="gt"
                     /db_xref="dbSNP:1561858807"
     variation       228
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1432689419"
     variation       229
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:553951373"
     variation       231
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1340775926"
     variation       233
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777310661"
     variation       234
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1483419984"
     variation       237
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1777310112"
     variation       240
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1450163111"
     variation       248
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1268187140"
     variation       249
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1208146203"
     variation       250
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:917183324"
     variation       256
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777308694"
     variation       258
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1777308361"
     variation       260
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:991404678"
     variation       264
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1238039827"
     variation       271
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:958551486"
     variation       274
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1314969939"
     variation       278
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1443317976"
     variation       279
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1290134588"
     variation       280..284
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="tgt"
                     /replace="tgtgt"
                     /db_xref="dbSNP:571828146"
     variation       280
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1240827545"
     variation       281
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:920402080"
     variation       283
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2151107235"
     variation       286
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:2151107222"
     variation       287
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:995080389"
     variation       289
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777304963"
     variation       294
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:961733064"
     variation       295
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1014676128"
     variation       297
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2151107175"
     variation       299
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777304114"
     variation       300..301
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="cc"
                     /replace="ccc"
                     /db_xref="dbSNP:1777303834"
     variation       302
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2151107154"
     variation       308
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1172171053"
     variation       313
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777303249"
     variation       314
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1402669669"
     variation       319
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1777302766"
     variation       320
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1280756512"
     variation       321
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1388044631"
     variation       323
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:72856737"
     variation       328
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:868073649"
     variation       329
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2151107091"
     variation       331
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:571668450"
     variation       333
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:759635638"
     variation       338
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2151107071"
     variation       340
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1368067216"
     variation       346
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1232121017"
     variation       348
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:545437201"
     variation       349
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:9263800"
     variation       355
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1777299299"
     variation       356
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777299064"
     variation       357
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:11965454"
     variation       358
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777298772"
     variation       364
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2151107008"
     variation       365
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2151106995"
     variation       366
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1282835556"
     variation       367..369
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="aca"
                     /db_xref="dbSNP:1429225310"
     variation       367
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1464849350"
     variation       369
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1473170859"
     variation       370
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777297246"
     variation       371
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:893827576"
     variation       374
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1250012422"
     variation       375
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1467154259"
     variation       376
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777296078"
     variation       377
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777295791"
     variation       380..381
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:1198482935"
     variation       380
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1777295522"
     variation       382..386
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="tttt"
                     /replace="ttttt"
                     /db_xref="dbSNP:1378392227"
     variation       384
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1777294937"
     variation       387
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777294345"
     variation       388
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777294068"
     variation       394
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1478925844"
     variation       396
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777293504"
     variation       397
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1156581301"
     variation       400
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1410882052"
     variation       404
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2151106839"
     variation       407
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:567697919"
     variation       409
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1322418862"
     variation       416
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:3757349"
     variation       434
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:903306193"
     variation       440
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1777291168"
     variation       443
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1777290863"
     variation       448
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2151106776"
     variation       450
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775390135"
     variation       451
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1323876773"
     variation       453
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1777289999"
     variation       455
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:905789598"
     variation       458..460
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="gag"
                     /db_xref="dbSNP:1777289394"
     variation       460..462
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="gtg"
                     /replace="gtgtg"
                     /db_xref="dbSNP:1777289142"
     variation       466
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:73401031"
     variation       468
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777288544"
     variation       477
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2151106706"
     variation       483
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:2151106697"
     variation       488
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2151106686"
     variation       489
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1777288254"
     variation       494..499
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="tt"
                     /replace="ttcttt"
                     /db_xref="dbSNP:550996676"
     variation       495..497
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="t"
                     /replace="tct"
                     /db_xref="dbSNP:1554135441"
     variation       496
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1554135451"
     variation       496
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1777287697"
     variation       497..508
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="ttttttttt"
                     /replace="tttttttttt"
                     /replace="ttttttttttt"
                     /replace="tttttttttttt"
                     /replace="ttttttttttttt"
                     /db_xref="dbSNP:rs9279005"
     variation       497
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1204843522"
     variation       502
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:949924521"
     variation       504
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1463720016"
     variation       507
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1269728421"
     variation       508
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201876558"
     variation       509
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1777284056"
     variation       509
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200941459"
     variation       513
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:1322683938"
     variation       513
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1209148552"
     variation       518..521
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="ag"
                     /replace="agag"
                     /db_xref="dbSNP:776463063"
     variation       518
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:1777282729"
     variation       521
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1254214943"
     variation       526
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1250844879"
     variation       527..530
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="ct"
                     /replace="ctct"
                     /db_xref="dbSNP:1234752211"
     variation       529
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777281473"
     variation       531
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1161350339"
     variation       534
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1777280491"
     variation       535
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777280177"
     variation       538
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:950118066"
     variation       540
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1457019029"
     variation       546
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:574609806"
     variation       547
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1582036271"
     variation       555
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1380101000"
     variation       556
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:983642581"
     variation       570
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1306970706"
     variation       575
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1582036200"
     variation       576
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777277431"
     variation       580
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1322911050"
     variation       581
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:929059992"
     variation       585
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777276499"
     variation       586
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1777276066"
     variation       587
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141017974"
     variation       588
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1300309753"
     variation       592
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1777274980"
     variation       595
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1777274684"
     variation       599
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1561857968"
     variation       604
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1582036092"
     variation       605
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777273790"
     variation       608
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:973063617"
     variation       609
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1582036067"
     variation       610
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:964318755"
     variation       611
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777272508"
     variation       625
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:151095308"
     variation       626
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1777271795"
     variation       628
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1582036011"
     variation       635
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777271173"
     variation       638
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1777270899"
     variation       641
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1203311467"
     variation       642
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1483285873"
     variation       644
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777269970"
     variation       646
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1245688817"
     variation       649
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:961842977"
     variation       650
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1423175744"
     variation       651
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777268707"
     variation       654
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:907643738"
     variation       655
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777268123"
     variation       659
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:533115866"
     variation       661
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:954544116"
     variation       662..666
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="tttt"
                     /replace="ttttt"
                     /db_xref="dbSNP:1561857858"
     variation       669
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1371755091"
     variation       674
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1167617089"
     variation       675
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777266300"
     variation       678
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1370782162"
     variation       683
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:779561772"
     variation       684
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777265399"
     variation       686
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:955078906"
     variation       687
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777264737"
     variation       692
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1377345590"
     variation       695
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1192583085"
     variation       697
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1314005077"
     variation       701
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1021109193"
     variation       706
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777263170"
     variation       718
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1028628180"
     variation       722
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1777261934"
     variation       725
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1010088871"
     variation       726
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777261360"
     variation       728
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1297231507"
     variation       729
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:893908328"
     variation       732
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1207472601"
     variation       733
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1032397103"
     variation       734
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2151105975"
     variation       736
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1460740055"
     variation       737
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1002211292"
     variation       744
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:562465318"
     variation       745
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1561857678"
     variation       755
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2151105898"
     variation       757
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1777258652"
     variation       759
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:770180344"
     variation       762
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:964250913"
     variation       763
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1242653526"
     variation       766
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1183137274"
     variation       768
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1440123342"
     variation       772
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1249038204"
     variation       773
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3132526"
     variation       774
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1561857616"
     variation       779
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:573636729"
     variation       780
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777255462"
     variation       782
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1291997215"
     variation       783
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1247763647"
     variation       784
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:756964786"
     variation       785
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:949991822"
     variation       786
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1442835906"
     variation       789
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1337392829"
     variation       793
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777253665"
     variation       794
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777253402"
     variation       795
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1777253136"
     variation       797
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2151105737"
     variation       800
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1357816400"
     variation       801
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1326790090"
     variation       802..816
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="taaccttcataacct"
                     /replace="taaccttcataaccttcataacct"
                     /db_xref="dbSNP:1777250501"
     variation       802
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1408941217"
     variation       807
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1303980168"
     variation       808
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1365998522"
     variation       810
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777251361"
     variation       811
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777251095"
     variation       815
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777250801"
     variation       824
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:746682206"
     variation       825..828
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="ttct"
                     /replace="ttcttct"
                     /db_xref="dbSNP:67257409"
     variation       825..826
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace=""
                     /replace="gc"
                     /db_xref="dbSNP:28728473"
     variation       825
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:777344152"
     variation       825
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="t"
                     /replace="tgct"
                     /db_xref="dbSNP:1561857487"
     variation       826..827
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace=""
                     /replace="atc"
                     /replace="gtc"
                     /replace="ttc"
                     /db_xref="dbSNP:2151105584"
     variation       826..827
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="tc"
                     /replace="tcctc"
                     /db_xref="dbSNP:1554135249"
     variation       826
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2070701153"
     variation       826
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:71563310"
     variation       827..829
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="ctc"
                     /replace="ctcctc"
                     /db_xref="dbSNP:9281234"
     variation       827..828
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="ct"
                     /replace="ctact"
                     /replace="ctgct"
                     /db_xref="dbSNP:2151105499"
     variation       827
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="cacc"
                     /replace="cc"
                     /replace="cccc"
                     /replace="cgcc"
                     /db_xref="dbSNP:rs1554135251"
     variation       828
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777247687"
     variation       829..830
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace=""
                     /replace="ctg"
                     /replace="ctt"
                     /db_xref="dbSNP:79966288"
     variation       829
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="ctcc"
                     /db_xref="dbSNP:1554135252"
     variation       830..831
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace=""
                     /replace="tca"
                     /replace="tcc"
                     /db_xref="dbSNP:1159152310"
     variation       830
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:752409659"
     variation       838
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1311441900"
     variation       839
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:561385932"
     variation       844..850
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="tct"
                     /replace="tctttct"
                     /db_xref="dbSNP:1471206311"
     variation       844
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:765257293"
     variation       847
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1252825210"
     variation       848
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:868416189"
     variation       853
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1362514380"
     variation       858
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1777243744"
     variation       860
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:754865454"
     variation       861
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1265163"
     variation       863
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1271554852"
     variation       867
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:920359564"
     variation       869
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777242610"
     variation       871
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2151105316"
     variation       873
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1561857278"
     variation       875
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:973093406"
     variation       879
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1777241739"
     variation       880
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1777241468"
     variation       882
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777241192"
     variation       885
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1489760262"
     variation       886
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1189136114"
     variation       888
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777240374"
     variation       894..898
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="gggg"
                     /replace="ggggg"
                     /db_xref="dbSNP:1423998752"
     variation       896
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1777240102"
     variation       897
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1288712416"
     variation       903
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1433024511"
     variation       904
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2151105201"
     variation       907
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1777238944"
     variation       908
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:572416729"
     variation       909
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:761916552"
     variation       913
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:910216174"
     variation       915
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:115513668"
     variation       918
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1456136909"
     variation       919
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1227753208"
     variation       935
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1345889080"
     variation       941
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:58535985"
     variation       942
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:58132172"
     variation       943
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1427955524"
     variation       945
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777235654"
     variation       946
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1055684992"
     variation       954
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1304792735"
     variation       958
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1437341593"
     variation       960
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:954964862"
     variation       962
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1021600248"
     variation       963
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1292063532"
     variation       963
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:1777233811"
     variation       966
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:76364340"
     variation       971
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1349458032"
     misc_feature    974..976
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /note="upstream in-frame stop codon"
     variation       976
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1303151899"
     variation       981
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1319251305"
     variation       983
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:763461206"
     variation       987
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1405930812"
     variation       991
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1159041236"
     variation       996
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:958411387"
     variation       998
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1481081875"
     variation       1001
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775689149"
     variation       1003
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1197635439"
     misc_feature    1004..1006
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /note="alternative start codon; OCT4B-265; polymorphic and
                     non-functional in this RefSeq"
     variation       1005
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:3130932"
     variation       1007
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:746349953"
     variation       1008
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2151104931"
     variation       1012
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1216104654"
     variation       1014
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:374060997"
     variation       1021
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:770437114"
     variation       1022
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1300240387"
     variation       1025
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1777227576"
     variation       1026
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:751818073"
     variation       1028
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:777447714"
     variation       1029
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1285130324"
     variation       1030
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1221408916"
     variation       1032
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1366683434"
     variation       1037
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1270956235"
     variation       1038
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:1343489733"
     variation       1038
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:748039347"
     variation       1041
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1320046736"
     variation       1045
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1470348977"
     variation       1048
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1192525392"
     variation       1054
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:9501063"
     variation       1055
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1174939469"
     variation       1057
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1471798553"
     variation       1058
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:753723388"
     variation       1060
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2151104758"
     variation       1062
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:780099361"
     variation       1063
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1159138802"
     variation       1064
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:374746302"
     variation       1068
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:751667986"
     variation       1069
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:764458539"
     variation       1072
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1187321294"
     variation       1074
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1461395860"
     variation       1078..1081
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace=""
                     /replace="ctgg"
                     /db_xref="dbSNP:1162777202"
     variation       1078
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:72856736"
     variation       1080
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1207984449"
     variation       1081
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1561856622"
     variation       1085
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1582033638"
     variation       1086
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1014613031"
     variation       1088
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:765521397"
     variation       1090
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777217414"
     variation       1091
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:759883550"
     variation       1094
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:777021724"
     variation       1095..1096
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace=""
                     /replace="tt"
                     /db_xref="dbSNP:1453409159"
     variation       1096
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:760230615"
     variation       1098
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1582033488"
     variation       1099
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:772698923"
     variation       1103
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771780451"
     variation       1106
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:747761780"
     variation       1108
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1355465893"
     variation       1115..1118
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="aaa"
                     /replace="aaaa"
                     /db_xref="dbSNP:1175259104"
     variation       1115
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777213682"
     variation       1121
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:778571821"
     variation       1125
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:768359010"
     variation       1128
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1489249310"
     variation       1129
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1387884870"
     variation       1132
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1167606498"
     variation       1135
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:749071230"
     variation       1136
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1408966195"
     variation       1137
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1288972831"
     variation       1139
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1244494688"
     variation       1140
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149025884"
     variation       1142
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1226467340"
     variation       1143
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:137936040"
     variation       1148
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777208385"
     variation       1156
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:751745427"
     variation       1157
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:777993058"
     variation       1159
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1321757885"
     variation       1162
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150320288"
     variation       1165
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1274145021"
     variation       1166
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2151104326"
     variation       1174
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1561856346"
     variation       1180
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777205659"
     variation       1185
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1777205330"
     variation       1192
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1247046824"
     variation       1195
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1361655165"
     variation       1196
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1272018324"
     variation       1204
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777203896"
     variation       1210
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1313084641"
     variation       1213
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1395953191"
     variation       1214
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1374605227"
     variation       1222
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:752871883"
     variation       1225
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1440419653"
     variation       1227
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:910240285"
     CDS             1229..1801
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /note="isoform 2 is encoded by transcript variant 2;
                     non-AUG (CUG) translation initiation codon; POU-type
                     homeodomain-containing DNA-binding protein; POU domain
                     transcription factor OCT4; POU domain, class 5,
                     transcription factor 1; octamer-binding protein 3;
                     octamer-binding protein 4; octamer-binding transcription
                     factor 3"
                     /codon_start=1
                     /product="POU domain, class 5, transcription factor 1
                     isoform 2"
                     /protein_id="NP_976034.4"
                     /db_xref="CCDS:CCDS47398.2"
                     /db_xref="GeneID:5460"
                     /db_xref="HGNC:HGNC:9221"
                     /db_xref="MIM:164177"
                     /translation="
MGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN"
     misc_feature    <1229..1354
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /note="Pou domain - N-terminal to homeobox domain; Region:
                     Pou; cl22952"
                     /db_xref="CDD:451464"
     misc_feature    1307..1309
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /note="OCT4B-164; Region: Alternative start codon"
     misc_feature    order(1409..1423,1427..1429,1478..1480,1496..1498,
                     1535..1537,1541..1546,1553..1558,1562..1570,1574..1579)
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    1415..1576
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     misc_feature    order(1415..1417,1424..1426,1544..1546,1553..1558,
                     1565..1567)
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     variation       1236
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1307000564"
     variation       1240
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1582032778"
     variation       1241
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1777200309"
     exon            1245..1375
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /inference="alignment:Splign:2.1.0"
     variation       1246
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:754269967"
     variation       1250
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1329745808"
     variation       1252
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:951425605"
     variation       1257
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1298706028"
     variation       1264
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:373808092"
     variation       1267
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1777172331"
     variation       1270
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1362025857"
     variation       1273
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1290187689"
     variation       1275
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777171228"
     variation       1291
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1455194086"
     variation       1295
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777170549"
     variation       1300
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1387743881"
     variation       1302
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:756413624"
     variation       1315
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777169354"
     variation       1318
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:115234511"
     variation       1319
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:768029325"
     variation       1320
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1037478772"
     variation       1324
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1429404142"
     variation       1332
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2151103219"
     variation       1345
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1341968669"
     variation       1350
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777167062"
     variation       1355
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1007322893"
     variation       1360
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1777166338"
     variation       1364
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:572480837"
     variation       1365
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1777165573"
     variation       1371
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1186685294"
     variation       1373
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:773889469"
     variation       1375
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:763710527"
     exon            1376..1534
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /inference="alignment:Splign:2.1.0"
     variation       1377
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777140852"
     variation       1378
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1777140477"
     variation       1379
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1441261772"
     variation       1380
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1256075529"
     variation       1383
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1196692240"
     variation       1387
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1016182724"
     variation       1394
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1150767"
     variation       1396
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:780201728"
     variation       1397
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:750755680"
     variation       1402
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:767958442"
     variation       1403
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1340827343"
     variation       1406
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1315221039"
     variation       1407
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1246353090"
     variation       1410
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777135286"
     variation       1411
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1338565059"
     variation       1416
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1333452170"
     variation       1418
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777134129"
     variation       1423
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1391716274"
     variation       1424
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777133457"
     variation       1426
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2151102295"
     variation       1429
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:757769384"
     variation       1434
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1306384765"
     variation       1436
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1429420206"
     variation       1437
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:751096375"
     variation       1438
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:368434272"
     variation       1440
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1471859282"
     variation       1441
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1368353231"
     variation       1443
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777130443"
     variation       1444
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1183206781"
     variation       1445
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1052108705"
     variation       1447
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:578180451"
     variation       1462
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:775301501"
     variation       1466
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1325738578"
     variation       1477
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:764939136"
     variation       1483
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:17851818"
     variation       1486
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:951452940"
     variation       1487
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777126425"
     variation       1489
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:776478147"
     variation       1497
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1353681075"
     variation       1500
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:770844532"
     variation       1505
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777125291"
     variation       1507
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:746974556"
     variation       1516
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1352084514"
     variation       1520
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1286303728"
     variation       1521
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1408995142"
     variation       1522
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1427351164"
     variation       1525
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:772966815"
     variation       1526
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:768746587"
     variation       1529
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:749326531"
     variation       1530
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777122104"
     variation       1532
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1390168415"
     exon            1535..2065
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /inference="alignment:Splign:2.1.0"
     variation       1535
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1188579160"
     variation       1536
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:770067555"
     variation       1537
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1246075526"
     variation       1540
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1777088374"
     variation       1541
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1208076129"
     variation       1542
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:746104715"
     variation       1543
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1384083039"
     variation       1545
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1280550252"
     variation       1546
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1298955101"
     variation       1548
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:867664390"
     variation       1552
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:781212227"
     variation       1560
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1271010739"
     variation       1561
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1437313632"
     variation       1562
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1777084166"
     variation       1564
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777083772"
     variation       1571
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777083413"
     variation       1572
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1363163301"
     variation       1577
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777082620"
     variation       1586
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:771345851"
     variation       1588
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141766253"
     variation       1589
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:778460021"
     variation       1593
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777081085"
     variation       1594
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1174320263"
     variation       1596
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:546320542"
     variation       1597..1601
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="ac"
                     /replace="acaac"
                     /db_xref="dbSNP:765569430"
     variation       1599
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777079901"
     variation       1600
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1423969939"
     variation       1602
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:950764201"
     variation       1604
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1486650077"
     variation       1613
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:758948344"
     variation       1624
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777077666"
     variation       1626
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:752325450"
     variation       1628
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1189046873"
     variation       1637
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:778574549"
     variation       1639
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1314271734"
     variation       1641
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1030266660"
     variation       1646
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1483497814"
     variation       1650
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:974056564"
     variation       1651
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1480295008"
     variation       1654
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777074060"
     variation       1658
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1200837847"
     variation       1659
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:16897482"
     variation       1661
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777072975"
     variation       1662
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1207698528"
     variation       1663
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1432082123"
     variation       1664
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1441659931"
     variation       1669
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:754481951"
     variation       1673
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1230947193"
     variation       1678
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1777070734"
     variation       1684
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:753553081"
     variation       1691
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:765910375"
     variation       1697
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777069475"
     variation       1699
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1246815764"
     variation       1702
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1158543431"
     variation       1705
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1374581600"
     variation       1711
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:997814201"
     variation       1714
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1301635040"
     variation       1717
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777067093"
     variation       1719
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:760558360"
     variation       1722
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1355522268"
     variation       1725
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:750163518"
     variation       1726
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:767500519"
     variation       1727
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1387940273"
     variation       1730
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1016136973"
     variation       1737
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1038848905"
     variation       1738
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:761734933"
     variation       1742
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:986006262"
     variation       1744
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777063161"
     variation       1748
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1348560317"
     variation       1750
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:953270489"
     variation       1751
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1284370986"
     variation       1752
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1318153696"
     variation       1756
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:774206292"
     variation       1757..1759
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace=""
                     /replace="cct"
                     /db_xref="dbSNP:1777060496"
     variation       1757
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:769875118"
     variation       1760
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777060142"
     variation       1765
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1061118"
     variation       1766
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1207558407"
     variation       1770
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1061120"
     variation       1773
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:776940833"
     variation       1776
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1274211726"
     variation       1778
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1222340156"
     variation       1779
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1777056973"
     variation       1780
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771024256"
     variation       1782
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1223697753"
     variation       1788
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:747446765"
     variation       1796
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1191115401"
     variation       1802
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1427929496"
     variation       1803
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:997296748"
     variation       1806
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:892230384"
     variation       1811
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1554134152"
     variation       1812
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:564148752"
     variation       1818
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1434585421"
     variation       1820..1821
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="aa"
                     /replace="aaa"
                     /db_xref="dbSNP:1408399482"
     variation       1821
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777052599"
     variation       1823..1827
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="gggg"
                     /replace="ggggg"
                     /db_xref="dbSNP:1351162048"
     variation       1823
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1368265136"
     variation       1825
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1307060444"
     variation       1827
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1457938687"
     variation       1829
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1162581262"
     variation       1830..1831
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace=""
                     /replace="ag"
                     /db_xref="dbSNP:1491028222"
     variation       1830
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:1163021077"
     variation       1830
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:1554134128"
     variation       1830
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:772503540"
     variation       1832
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:748680648"
     variation       1838
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777048797"
     variation       1840
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1777048444"
     variation       1841
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:903483977"
     variation       1842
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779517517"
     variation       1845
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:754549702"
     variation       1849
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1251306973"
     variation       1855
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777046704"
     variation       1857
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1061126"
     variation       1862
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777045960"
     variation       1867..1869
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="tt"
                     /replace="ttt"
                     /db_xref="dbSNP:1777045583"
     variation       1870
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777045236"
     variation       1872
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1777044891"
     variation       1873
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1304742773"
     variation       1874
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2151100101"
     variation       1876
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3734864"
     variation       1877
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1409164251"
     variation       1878
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1189358100"
     variation       1879
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1777042927"
     variation       1904
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1472556225"
     variation       1906
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1249631450"
     variation       1916
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1226100360"
     variation       1920
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1777041453"
     variation       1926..1928
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="aaa"
                     /replace="aaaaa"
                     /db_xref="dbSNP:60004964"
     variation       1926
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1777041138"
     variation       1927
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200275741"
     variation       1931
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:917547918"
     variation       1935
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:896681857"
     variation       1946..1948
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="tt"
                     /replace="ttt"
                     /db_xref="dbSNP:746543478"
     variation       1949..1952
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="gggg"
                     /replace="ggggg"
                     /db_xref="dbSNP:1777038521"
     variation       1950
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:938900222"
     variation       1952
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1482261391"
     variation       1953
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1057051690"
     variation       1955
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777037472"
     variation       1960
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1233955454"
     variation       1971
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1777036766"
     variation       1982
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777036406"
     variation       1993
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:930130200"
     variation       2003
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:537327593"
     variation       2004
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1481698220"
     variation       2005
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1265122857"
     variation       2006
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777034633"
     variation       2009
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:927467930"
     variation       2012
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:980276667"
     variation       2013
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2151099846"
     variation       2017
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1777033427"
     variation       2018
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1388129250"
     variation       2020
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1777032759"
     variation       2026..2033
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="taaa"
                     /replace="taaataaa"
                     /db_xref="dbSNP:1409128704"
     variation       2027..2029
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="aa"
                     /replace="aaa"
                     /db_xref="dbSNP:1777032031"
     variation       2027
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1323343063"
     regulatory      2028..2033
                     /regulatory_class="polyA_signal_sequence"
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /note="hexamer: AATAAA"
     variation       2031..2036
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="aa"
                     /replace="aaagaa"
                     /db_xref="dbSNP:1777031252"
     variation       2037..2039
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace=""
                     /replace="gcc"
                     /db_xref="dbSNP:750617181"
     variation       2038
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1313339858"
     variation       2039
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:13409"
     variation       2048
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1356217144"
     variation       2050
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1777029217"
     variation       2054
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777028855"
     variation       2055..2057
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="aga"
                     /db_xref="dbSNP:1777028490"
     variation       2058
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:983923886"
     variation       2061
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1445660115"
     variation       2064
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:974089105"
     polyA_site      2065
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /note="major polyA site"
ORIGIN      
ggaaaaaaggaaagtgcacttggaagagatccaagtgggcaacttgaagaacaagtgccaaatagcacttctgtcatgctggatgtcagggctctttgtccactttgtatagccgctggcttatagaaggtgctcgataaatctcttgaatttaaaaatcaattaggatgcctctatagtgaaaaagatacagtaaagatgagggataatcaatttaaaaaatgagtaagtacacacaaagcactttatccattcttatgacacctgttacttttttgctgtgtttgtgtgtatgcatgccatgttatagtttgtgggaccctcaaagcaagctggggagagtatatactgaatttagcttctgagacatgatgctcttcctttttaattaacccagaacttagcagcttatctatttctctaatctcaaaacatccttaaactgggggtgatacttgagtgagagaattttgcaggtattaaatgaactatcttcttttttttttttctttgagacagagtcttgctctgtcacccaggctggagtgcagtggcgtgatctcagctcactgcaacctccgcctcccgggttcaagtgattctcctgcctcagcctcctgagtagctgggattacaggtgcgtgccaccgtgcccagctaatttttgtgtttttagtagagacggggtttcaccatgttggccatgctggtcttgaactcctgacctcgtgatctgcccacctcggcctcccaaagtgctggaattataggcgtgagccaccgcgcccagcaaagaacttctaaccttcataacctgacaggtgttctcgaggccagggtctctctttctgtcctttcacgatgctctgcatcccttggatgtgccagtttctgggggaagagtagtcctttgttacatgcatgagtcagtgaacagggaatgggtgaatgacatttgtgggtaggttatttctagaagttaggtgggcagcttggaaggcagaggcacttctacagactattccttggggccacacgtaggttcttgaatcccgaatggaaaggggagattgataactggtgtgtttatgttcttacaagtcttctgccttttaaaatccagtcccaggacatcaaagctctgcagaaagaactcgagcaatttgccaagctcctgaagcagaagaggatcaccctgggatatacacaggccgatgtggggctcaccctgggggttctatttgggaaggtattcagccaaacgaccatctgccgctttgaggctctgcagcttagcttcaagaacatgtgtaagctgcggcccttgctgcagaagtgggtggaggaagctgacaacaatgaaaatcttcaggagatatgcaaagcagaaaccctcgtgcaggcccgaaagagaaagcgaaccagtatcgagaaccgagtgagaggcaacctggagaatttgttcctgcagtgcccgaaacccacactgcagcagatcagccacatcgcccagcagcttgggctcgagaaggatgtggtccgagtgtggttctgtaaccggcgccagaagggcaagcgatcaagcagcgactatgcacaacgagaggattttgaggctgctgggtctcctttctcagggggaccagtgtcctttcctctggccccagggccccattttggtaccccaggctatgggagccctcacttcactgcactgtactcctcggtccctttccctgagggggaagcctttccccctgtctccgtcaccactctgggctctcccatgcattcaaactgaggtgcctgcccttctaggaatgggggacagggggaggggaggagctagggaaagaaaacctggagtttgtgccagggtttttgggattaagttcttcattcactaaggaaggaattgggaacacaaagggtgggggcaggggagtttggggcaactggttggagggaaggtgaagttcaatgatgctcttgattttaatcccacatcatgtatcacttttttcttaaataaagaagcctgggacacagtagatagacacactta
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]