GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-08-30 15:21:31, GGRNA.v2 : RefSeq release 231 (Jul, 2025)

LOCUS       NM_001438051            2116 bp    mRNA    linear   PRI 15-APR-2025
DEFINITION  Homo sapiens serine protease 16 (PRSS16), transcript variant 2,
            mRNA.
ACCESSION   NM_001438051 XM_017010165 XM_054354022
VERSION     NM_001438051.1
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 2116)
  AUTHORS   Serre,L., Girard,M., Ramadan,A., Menut,P., Rouquie,N., Lucca,L.E.,
            Mahiddine,K., Leobon,B., Mars,L.T. and Guerder,S.
  TITLE     Thymic-Specific Serine Protease Limits Central Tolerance and
            Exacerbates Experimental Autoimmune Encephalomyelitis
  JOURNAL   J Immunol 199 (11), 3748-3756 (2017)
   PUBMED   29061767
  REMARK    GeneRIF: the level of TSSP expression by thymic dendritic cells may
            modify the risk factors for multiple sclerosis conferred by some
            MHC class II haplotypes
REFERENCE   2  (bases 1 to 2116)
  AUTHORS   Kitazawa,M., Ohnuma,T., Takebayashi,Y., Shibata,N., Baba,H.,
            Ohi,K., Yasuda,Y., Nakamura,Y., Aleksic,B., Yoshimi,A., Okochi,T.,
            Ikeda,M., Naitoh,H., Hashimoto,R., Iwata,N., Ozaki,N., Takeda,M.
            and Arai,H.
  TITLE     No associations found between the genes situated at 6p22.1,
            HIST1H2BJ, PRSS16, and PGBD1 in Japanese patients diagnosed with
            schizophrenia
  JOURNAL   Am J Med Genet B Neuropsychiatr Genet 159B (4), 456-464 (2012)
   PUBMED   22488895
  REMARK    GeneRIF: The genes HIST1H2BJ, PRSS16, and PGBD1 were not associated
            with Japanese patients with schizophrenia.
REFERENCE   3  (bases 1 to 2116)
  AUTHORS   Girgenti,M.J., LoTurco,J.J. and Maher,B.J.
  TITLE     ZNF804a regulates expression of the schizophrenia-associated genes
            PRSS16, COMT, PDE4B, and DRD2
  JOURNAL   PLoS One 7 (2), e32404 (2012)
   PUBMED   22384243
  REMARK    GeneRIF: ZNF804a regulates expression of the
            schizophrenia-associated genes PRSS16, COMT, PDE4B, and DRD2
REFERENCE   4  (bases 1 to 2116)
  AUTHORS   Shi,J., Levinson,D.F., Duan,J., Sanders,A.R., Zheng,Y., Pe'er,I.,
            Dudbridge,F., Holmans,P.A., Whittemore,A.S., Mowry,B.J., Olincy,A.,
            Amin,F., Cloninger,C.R., Silverman,J.M., Buccola,N.G.,
            Byerley,W.F., Black,D.W., Crowe,R.R., Oksenberg,J.R., Mirel,D.B.,
            Kendler,K.S., Freedman,R. and Gejman,P.V.
  TITLE     Common variants on chromosome 6p22.1 are associated with
            schizophrenia
  JOURNAL   Nature 460 (7256), 753-757 (2009)
   PUBMED   19571809
  REMARK    GeneRIF: Observational study, meta-analysis, and genome-wide
            association study of gene-disease association. (HuGE Navigator)
REFERENCE   5  (bases 1 to 2116)
  AUTHORS   Stefansson,H., Ophoff,R.A., Steinberg,S., Andreassen,O.A.,
            Cichon,S., Rujescu,D., Werge,T., Pietilainen,O.P., Mors,O.,
            Mortensen,P.B., Sigurdsson,E., Gustafsson,O., Nyegaard,M.,
            Tuulio-Henriksson,A., Ingason,A., Hansen,T., Suvisaari,J.,
            Lonnqvist,J., Paunio,T., Borglum,A.D., Hartmann,A., Fink-Jensen,A.,
            Nordentoft,M., Hougaard,D., Norgaard-Pedersen,B., Bottcher,Y.,
            Olesen,J., Breuer,R., Moller,H.J., Giegling,I., Rasmussen,H.B.,
            Timm,S., Mattheisen,M., Bitter,I., Rethelyi,J.M.,
            Magnusdottir,B.B., Sigmundsson,T., Olason,P., Masson,G.,
            Gulcher,J.R., Haraldsson,M., Fossdal,R., Thorgeirsson,T.E.,
            Thorsteinsdottir,U., Ruggeri,M., Tosato,S., Franke,B.,
            Strengman,E., Kiemeney,L.A., Melle,I., Djurovic,S., Abramova,L.,
            Kaleda,V., Sanjuan,J., de Frutos,R., Bramon,E., Vassos,E.,
            Fraser,G., Ettinger,U., Picchioni,M., Walker,N., Toulopoulou,T.,
            Need,A.C., Ge,D., Yoon,J.L., Shianna,K.V., Freimer,N.B.,
            Cantor,R.M., Murray,R., Kong,A., Golimbet,V., Carracedo,A.,
            Arango,C., Costas,J., Jonsson,E.G., Terenius,L., Agartz,I.,
            Petursson,H., Nothen,M.M., Rietschel,M., Matthews,P.M., Muglia,P.,
            Peltonen,L., St Clair,D., Goldstein,D.B., Stefansson,K. and
            Collier,D.A.
  CONSRTM   Genetic Risk and Outcome in Psychosis (GROUP)
  TITLE     Common variants conferring risk of schizophrenia
  JOURNAL   Nature 460 (7256), 744-747 (2009)
   PUBMED   19571808
REFERENCE   6  (bases 1 to 2116)
  AUTHORS   Luther,C., Wienhold,W., Oehlmann,R., Heinemann,M.K., Melms,A. and
            Tolosa,E.
  TITLE     Alternatively spliced transcripts of the thymus-specific protease
            PRSS16 are differentially expressed in human thymus
  JOURNAL   Genes Immun 6 (1), 1-7 (2005)
   PUBMED   15592422
REFERENCE   7  (bases 1 to 2116)
  AUTHORS   Mungall,A.J., Palmer,S.A., Sims,S.K., Edwards,C.A., Ashurst,J.L.,
            Wilming,L., Jones,M.C., Horton,R., Hunt,S.E., Scott,C.E.,
            Gilbert,J.G., Clamp,M.E., Bethel,G., Milne,S., Ainscough,R.,
            Almeida,J.P., Ambrose,K.D., Andrews,T.D., Ashwell,R.I.,
            Babbage,A.K., Bagguley,C.L., Bailey,J., Banerjee,R., Barker,D.J.,
            Barlow,K.F., Bates,K., Beare,D.M., Beasley,H., Beasley,O.,
            Bird,C.P., Blakey,S., Bray-Allen,S., Brook,J., Brown,A.J.,
            Brown,J.Y., Burford,D.C., Burrill,W., Burton,J., Carder,C.,
            Carter,N.P., Chapman,J.C., Clark,S.Y., Clark,G., Clee,C.M.,
            Clegg,S., Cobley,V., Collier,R.E., Collins,J.E., Colman,L.K.,
            Corby,N.R., Coville,G.J., Culley,K.M., Dhami,P., Davies,J.,
            Dunn,M., Earthrowl,M.E., Ellington,A.E., Evans,K.A., Faulkner,L.,
            Francis,M.D., Frankish,A., Frankland,J., French,L., Garner,P.,
            Garnett,J., Ghori,M.J., Gilby,L.M., Gillson,C.J., Glithero,R.J.,
            Grafham,D.V., Grant,M., Gribble,S., Griffiths,C., Griffiths,M.,
            Hall,R., Halls,K.S., Hammond,S., Harley,J.L., Hart,E.A.,
            Heath,P.D., Heathcott,R., Holmes,S.J., Howden,P.J., Howe,K.L.,
            Howell,G.R., Huckle,E., Humphray,S.J., Humphries,M.D., Hunt,A.R.,
            Johnson,C.M., Joy,A.A., Kay,M., Keenan,S.J., Kimberley,A.M.,
            King,A., Laird,G.K., Langford,C., Lawlor,S., Leongamornlert,D.A.,
            Leversha,M., Lloyd,C.R., Lloyd,D.M., Loveland,J.E., Lovell,J.,
            Martin,S., Mashreghi-Mohammadi,M., Maslen,G.L., Matthews,L.,
            McCann,O.T., McLaren,S.J., McLay,K., McMurray,A., Moore,M.J.,
            Mullikin,J.C., Niblett,D., Nickerson,T., Novik,K.L., Oliver,K.,
            Overton-Larty,E.K., Parker,A., Patel,R., Pearce,A.V., Peck,A.I.,
            Phillimore,B., Phillips,S., Plumb,R.W., Porter,K.M., Ramsey,Y.,
            Ranby,S.A., Rice,C.M., Ross,M.T., Searle,S.M., Sehra,H.K.,
            Sheridan,E., Skuce,C.D., Smith,S., Smith,M., Spraggon,L.,
            Squares,S.L., Steward,C.A., Sycamore,N., Tamlyn-Hall,G., Tester,J.,
            Theaker,A.J., Thomas,D.W., Thorpe,A., Tracey,A., Tromans,A.,
            Tubby,B., Wall,M., Wallis,J.M., West,A.P., White,S.S.,
            Whitehead,S.L., Whittaker,H., Wild,A., Willey,D.J., Wilmer,T.E.,
            Wood,J.M., Wray,P.W., Wyatt,J.C., Young,L., Younger,R.M.,
            Bentley,D.R., Coulson,A., Durbin,R., Hubbard,T., Sulston,J.E.,
            Dunham,I., Rogers,J. and Beck,S.
  TITLE     The DNA sequence and analysis of human chromosome 6
  JOURNAL   Nature 425 (6960), 805-811 (2003)
   PUBMED   14574404
REFERENCE   8  (bases 1 to 2116)
  AUTHORS   Lie,B.A., Akselsen,H.E., Bowlus,C.L., Gruen,J.R., Thorsby,E. and
            Undlien,D.E.
  TITLE     Polymorphisms in the gene encoding thymus-specific serine protease
            in the extended HLA complex: a potential candidate gene for
            autoimmune and HLA-associated diseases
  JOURNAL   Genes Immun 3 (5), 306-312 (2002)
   PUBMED   12140752
  REMARK    GeneRIF: The gene encoding thymus-specific serine protease (PRSS16)
            maps to the extended HLA complex, which harbours several genes
            predisposing for autoimmune diseases.
REFERENCE   9  (bases 1 to 2116)
  AUTHORS   Bowlus,C.L., Ahn,J., Chu,T. and Gruen,J.R.
  TITLE     Cloning of a novel MHC-encoded serine peptidase highly expressed by
            cortical epithelial cells of the thymus
  JOURNAL   Cell Immunol 196 (2), 80-86 (1999)
   PUBMED   10527559
REFERENCE   10 (bases 1 to 2116)
  AUTHORS   Gruen,J.R., Nalabolu,S.R., Chu,T.W., Bowlus,C., Fan,W.F.,
            Goei,V.L., Wei,H., Sivakamasundari,R., Liu,Y., Xu,H.X., Parimoo,S.,
            Nallur,G., Ajioka,R., Shukla,H., Bray-Ward,P., Pan,J. and
            Weissman,S.M.
  TITLE     A transcription map of the major histocompatibility complex (MHC)
            class I region
  JOURNAL   Genomics 36 (1), 70-85 (1996)
   PUBMED   8812418
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AL021808.2.
            
            On or before Apr 15, 2025 this sequence version replaced
            XM_017010165.2, XM_054354022.1.
            
            Summary: This gene encodes a serine protease expressed exclusively
            in the thymus. It is thought to play a role in the alternative
            antigen presenting pathway used by cortical thymic epithelial cells
            during the positive selection of T cells. The gene is found in the
            large histone gene cluster on chromosome 6, near the major
            histocompatibility complex (MHC) class I region. A second
            transcript variant has been described, but its full length nature
            has not been determined. [provided by RefSeq, Jul 2008].
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: AK097918.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMN03465418 [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-107               AL021808.2         32929-33035
            108-274             AL021808.2         33110-33276
            275-416             AL021808.2         38036-38177
            417-596             AL021808.2         39921-40100
            597-742             AL021808.2         40214-40359
            743-2116            AL021808.2         40475-41848
FEATURES             Location/Qualifiers
     source          1..2116
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="6"
                     /map="6p22.1"
     gene            1..2116
                     /gene="PRSS16"
                     /gene_synonym="TSSP"
                     /note="serine protease 16"
                     /db_xref="GeneID:10279"
                     /db_xref="HGNC:HGNC:9480"
                     /db_xref="MIM:607169"
     exon            1..107
                     /gene="PRSS16"
                     /gene_synonym="TSSP"
                     /inference="alignment:Splign:2.1.0"
     CDS             38..811
                     /gene="PRSS16"
                     /gene_synonym="TSSP"
                     /note="isoform 2 is encoded by transcript variant 2;
                     thymus specific serine peptidase; thymus-specific serine
                     protease; protease, serine, 16 (thymus); protease, serine
                     16"
                     /codon_start=1
                     /product="thymus-specific serine protease isoform 2"
                     /protein_id="NP_001424980.1"
                     /db_xref="GeneID:10279"
                     /db_xref="HGNC:HGNC:9480"
                     /db_xref="MIM:607169"
                     /translation="
MAVWLAQWLGPLLLVSLWGLLAPASLLRRLGEHIQQFQESSAQGLGLSLGPGAAALPKVGWLEQLLDPFNVSDRRSFLQIVLHSLGQKCLSFSRAETVAQLRSTEPQLSGVGDRQWLYQTCTEFGFYVTCENPRCPFSQLPALPSQLDLCEQVFGLSALSVAQAVAQTNSYYGGQTPGANKVLFVNGDTDPWHVLSVTQALGSSESTLLIRTGSHCLDMAPERPSDSPSLRLGRQNIFQQLQTWLKLAKESQIKGEV"
     misc_feature    245..247
                     /gene="PRSS16"
                     /gene_synonym="TSSP"
                     /note="N-linked (GlcNAc...) asparagine.
                     /evidence=ECO:0000255; propagated from
                     UniProtKB/Swiss-Prot (Q9NQE7.2); glycosylation site"
     exon            108..274
                     /gene="PRSS16"
                     /gene_synonym="TSSP"
                     /inference="alignment:Splign:2.1.0"
     exon            275..416
                     /gene="PRSS16"
                     /gene_synonym="TSSP"
                     /inference="alignment:Splign:2.1.0"
     exon            417..596
                     /gene="PRSS16"
                     /gene_synonym="TSSP"
                     /inference="alignment:Splign:2.1.0"
     exon            597..742
                     /gene="PRSS16"
                     /gene_synonym="TSSP"
                     /inference="alignment:Splign:2.1.0"
     exon            743..2116
                     /gene="PRSS16"
                     /gene_synonym="TSSP"
                     /inference="alignment:Splign:2.1.0"
     regulatory      1009..1014
                     /regulatory_class="polyA_signal_sequence"
                     /gene="PRSS16"
                     /gene_synonym="TSSP"
                     /note="hexamer: AATATA"
     polyA_site      1039
                     /gene="PRSS16"
                     /gene_synonym="TSSP"
                     /note="major polyA site"
     regulatory      1929..1934
                     /regulatory_class="polyA_signal_sequence"
                     /gene="PRSS16"
                     /gene_synonym="TSSP"
                     /note="hexamer: AATAAA"
     polyA_site      1953
                     /gene="PRSS16"
                     /gene_synonym="TSSP"
                     /note="major polyA site"
     regulatory      2094..2099
                     /regulatory_class="polyA_signal_sequence"
                     /gene="PRSS16"
                     /gene_synonym="TSSP"
                     /note="hexamer: TATAAA"
     polyA_site      2116
                     /gene="PRSS16"
                     /gene_synonym="TSSP"
ORIGIN      
aaaggtcctcctgggggagaacagagtcccgaacaccatggccgtctggcttgcccagtggctgggccctctgctcttggtttccctctggggactcttggctccagcctcccttcttaggcgcctgggtgagcacattcagcagtttcaggagagctctgcccagggcctgggcctgagcctggggccaggtgctgcagccctcccaaaagtggggtggctggagcaactgctggaccccttcaacgtgtccgacagacgatccttcctacagattgtcttgcacagcctgggccagaagtgtttaagcttttcccgagcagagacagtggcacagctgaggagcacagaacctcaactgtctggtgtgggtgaccggcagtggttgtatcagacatgtaccgagttcggcttctatgtcacctgtgagaatcccagatgtcctttctcccagctcccagcactgccctcccagctagacctatgtgagcaggtgtttgggctctcagccttgtcagtagcccaggctgtggctcagacgaactcctactacggtggccagacccctggggctaacaaagtgctgtttgttaatggggacacagacccctggcatgtgctaagtgtaacacaggctttaggatcctcagaatcaactcttcttatccgcactggctcccactgcttggacatggcacctgagaggccctcagactcccccagcctccgcctagggcgccagaacatcttccagcagctacagacctggctcaagctggcaaaggagagccagattaagggtgaagtctgaatctcataccctttccactccctgcatggtcacctcagtcctggacatacttgttcactgaacaaaagaaagcagcttgttttgaaagaagaaactcccaggaattggaattcagcacctgttccgcacgtaattggcatgtgtctgcaaacatccttattcccaacttaaagtgctttattgcagagagttatggaaatataagtggatgattattctcattgtaaatattggtattttgaatgttaaatgtcaaacaaatgtgacttatgctggtgccctcgccctgctgatcagattctggttcaaattctgccactccagctcctgggttaggggctttgctgtaagtttctttttctggactttagatcctgaacctgtccttgcttctcagtttctctcactgtacccctttccctcagtctcttcctctctctttcccctgtcactatttgtctttctaatctccttctgtttctctgaatatcttcatttctatctctgtgtttctgtctatttctctgtttatctttctgtccttcaatctgtgtttttgtttctggctctccgtcagtgtctttttctctcctctctctcttgctctgccatggctatttccactgctctatttctgactctcatttttggtctctgtgtgtctcctagtcactttctttctcactctgtctctgtctctatttctgtctctcctctgctgtgtcctcaatctctctgtctccctgaggctctatttctgtctctcctctgctgtgtcctcaatctctctgtctccctgaggctctatttctgtctctgatgctcttcttctgtgtctctatttctcttcctgtcacttaatcttttccttctctatctctcttatttagtcttccttccacacccttcactcaccatcttttcccacaatcaaatatcactccctggtacttccagcttccaactctagggattcatgattctggtggagattccttcttccagggcctgggaggatagggctaatcccaagggtgcctgcttaggctatgttagctgtgacaggaacctgccatagatttgcactgttctttcctaaagatcaattattttcagcaataaatacttctcagctttttgtatgtctttgtatgcacagagatggtagttttagagttttatccagtttcatatttccttgtgggtaagaggcaacctcctcatgctgtcataccaaagtcaatctccactacactttagttctgcctgttcttgatctttatataaatggaaacttgcagtata
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]