LOCUS       NM_001424649            1616 bp    mRNA    linear   PRI 01-MAY-2025
DEFINITION  Homo sapiens dual specificity phosphatase 11 (DUSP11), transcript
            variant 2, mRNA.
ACCESSION   NM_001424649
VERSION     NM_001424649.1
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1616)
  AUTHORS   Santos,V.S., Vieira,G.M., Ruckert,M.T., Andrade,P.V., Nagano,L.F.,
            Brunaldi,M.O., Dos Santos,J.S. and Silveira,V.S.
  TITLE     Atypical phosphatase DUSP11 inhibition promotes nc886 expression
            and potentiates gemcitabine-mediated cell death through NF-kB
            modulation
  JOURNAL   Cancer Gene Ther 31 (9), 1402-1411 (2024)
   PUBMED   39048662
  REMARK    GeneRIF: Atypical phosphatase DUSP11 inhibition promotes nc886
            expression and potentiates gemcitabine-mediated cell death through
            NF-kB modulation.
REFERENCE   2  (bases 1 to 1616)
  AUTHORS   Morgenstern,M., Peikert,C.D., Lubbert,P., Suppanz,I., Klemm,C.,
            Alka,O., Steiert,C., Naumenko,N., Schendzielorz,A., Melchionda,L.,
            Muhlhauser,W.W.D., Knapp,B., Busch,J.D., Stiller,S.B.,
            Dannenmaier,S., Lindau,C., Licheva,M., Eickhorst,C., Galbusera,R.,
            Zerbes,R.M., Ryan,M.T., Kraft,C., Kozjak-Pavlovic,V., Drepper,F.,
            Dennerlein,S., Oeljeklaus,S., Pfanner,N., Wiedemann,N. and
            Warscheid,B.
  TITLE     Quantitative high-confidence human mitochondrial proteome and its
            dynamics in cellular context
  JOURNAL   Cell Metab 33 (12), 2464-2483 (2021)
   PUBMED   34800366
REFERENCE   3  (bases 1 to 1616)
  AUTHORS   Kincaid,R.P., Lam,V.L., Chirayil,R.P., Randall,G. and Sullivan,C.S.
  TITLE     RNA triphosphatase DUSP11 enables exonuclease XRN-mediated
            restriction of hepatitis C virus
  JOURNAL   Proc Natl Acad Sci U S A 115 (32), 8197-8202 (2018)
   PUBMED   30038017
  REMARK    GeneRIF: Results implicate DUSP11 as an important component of
            XRN-mediated restriction of hepatitis C virus replication.
REFERENCE   4  (bases 1 to 1616)
  AUTHORS   Amador-Canizares,Y., Bernier,A., Wilson,J.A. and Sagan,S.M.
  TITLE     miR-122 does not impact recognition of the HCV genome by innate
            sensors of RNA but rather protects the 5' end from the cellular
            pyrophosphatases, DOM3Z and DUSP11
  JOURNAL   Nucleic Acids Res 46 (10), 5139-5158 (2018)
   PUBMED   29672716
  REMARK    GeneRIF: DUSP11 limits both miR-122-dependent and
            miR-122-independent Hepatitis C RNA accumulation.
REFERENCE   5  (bases 1 to 1616)
  AUTHORS   Carrillo,D., Munoz,J.P., Huerta,H., Leal,G., Corvalan,A., Leon,O.,
            Calaf,G.M., Urzua,U., Boccardo,E., Tapia,J.C. and Aguayo,F.
  TITLE     Upregulation of PIR gene expression induced by human papillomavirus
            E6 and E7 in epithelial oral and cervical cells
  JOURNAL   Open Biol 7 (11) (2017)
   PUBMED   29118270
  REMARK    GeneRIF: PIR gene expression is highly dependent on the expression
            of HR-HPV E6 and E7 oncoproteins HPV-positive cell lines.
REFERENCE   6  (bases 1 to 1616)
  AUTHORS   Chambers,J.C., Zhang,W., Lord,G.M., van der Harst,P., Lawlor,D.A.,
            Sehmi,J.S., Gale,D.P., Wass,M.N., Ahmadi,K.R., Bakker,S.J.,
            Beckmann,J., Bilo,H.J., Bochud,M., Brown,M.J., Caulfield,M.J.,
            Connell,J.M., Cook,H.T., Cotlarciuc,I., Davey Smith,G., de
            Silva,R., Deng,G., Devuyst,O., Dikkeschei,L.D., Dimkovic,N.,
            Dockrell,M., Dominiczak,A., Ebrahim,S., Eggermann,T., Farrall,M.,
            Ferrucci,L., Floege,J., Forouhi,N.G., Gansevoort,R.T., Han,X.,
            Hedblad,B., Homan van der Heide,J.J., Hepkema,B.G.,
            Hernandez-Fuentes,M., Hypponen,E., Johnson,T., de Jong,P.E.,
            Kleefstra,N., Lagou,V., Lapsley,M., Li,Y., Loos,R.J., Luan,J.,
            Luttropp,K., Marechal,C., Melander,O., Munroe,P.B., Nordfors,L.,
            Parsa,A., Peltonen,L., Penninx,B.W., Perucha,E., Pouta,A.,
            Prokopenko,I., Roderick,P.J., Ruokonen,A., Samani,N.J., Sanna,S.,
            Schalling,M., Schlessinger,D., Schlieper,G., Seelen,M.A.,
            Shuldiner,A.R., Sjogren,M., Smit,J.H., Snieder,H., Soranzo,N.,
            Spector,T.D., Stenvinkel,P., Sternberg,M.J., Swaminathan,R.,
            Tanaka,T., Ubink-Veltmaat,L.J., Uda,M., Vollenweider,P.,
            Wallace,C., Waterworth,D., Zerres,K., Waeber,G., Wareham,N.J.,
            Maxwell,P.H., McCarthy,M.I., Jarvelin,M.R., Mooser,V.,
            Abecasis,G.R., Lightstone,L., Scott,J., Navis,G., Elliott,P. and
            Kooner,J.S.
  TITLE     Genetic loci influencing kidney function and chronic kidney disease
  JOURNAL   Nat Genet 42 (5), 373-375 (2010)
   PUBMED   20383145
REFERENCE   7  (bases 1 to 1616)
  AUTHORS   Caprara,G., Zamponi,R., Melixetian,M. and Helin,K.
  TITLE     Isolation and characterization of DUSP11, a novel p53 target gene
  JOURNAL   J Cell Mol Med 13 (8B), 2158-2170 (2009)
   PUBMED   19120688
  REMARK    GeneRIF: results suggest that DUSP11 contributes to p53-dependent
            inhibition of cell proliferation and that it might be involved in
            regulating RNA splicing through SAM68
REFERENCE   8  (bases 1 to 1616)
  AUTHORS   Andersen,J.S., Lam,Y.W., Leung,A.K., Ong,S.E., Lyon,C.E.,
            Lamond,A.I. and Mann,M.
  TITLE     Nucleolar proteome dynamics
  JOURNAL   Nature 433 (7021), 77-83 (2005)
   PUBMED   15635413
REFERENCE   9  (bases 1 to 1616)
  AUTHORS   Deshpande,T., Takagi,T., Hao,L., Buratowski,S. and Charbonneau,H.
  TITLE     Human PIR1 of the protein-tyrosine phosphatase superfamily has RNA
            5'-triphosphatase and diphosphatase activities
  JOURNAL   J Biol Chem 274 (23), 16590-16594 (1999)
   PUBMED   10347225
REFERENCE   10 (bases 1 to 1616)
  AUTHORS   Yuan,Y., Li,D.M. and Sun,H.
  TITLE     PIR1, a novel phosphatase that exhibits high affinity to RNA .
            ribonucleoprotein complexes
  JOURNAL   J Biol Chem 273 (32), 20347-20353 (1998)
   PUBMED   9685386
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AC092653.3.
            
            Summary: The protein encoded by this gene is a member of the dual
            specificity protein phosphatase subfamily. These phosphatases
            inactivate their target kinases by dephosphorylating both the
            phosphoserine/threonine and phosphotyrosine residues. They
            negatively regulate members of the mitogen-activated protein (MAP)
            kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which is associated
            with cellular proliferation and differentiation. Different members
            of the family of dual specificity phosphatases show distinct
            substrate specificities for various MAP kinases, different tissue
            distribution and subcellular localization, and different modes of
            inducibility of their expression by extracellular stimuli. This
            gene product is localized to the nucleus and binds directly to RNA
            and splicing factors, and thus it is suggested to participate in
            nuclear mRNA metabolism. [provided by RefSeq, Sep 2008].
            
            Transcript Variant: This transcript variant (2) uses upstream
            transcription and translation start sites compared to transcript
            variant 1. The encoded isoform (2) has a longer N-terminus than
            isoform 1.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC000346.2, AF023917.1 [ECO:0000332]
            RNAseq introns              :: mixed sample support SAMEA1965299,
                                           SAMEA1966682 [ECO:0006172]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-276               AC092653.3         190007-190282       c
            277-352             AC092653.3         188434-188509       c
            353-484             AC092653.3         185046-185177       c
            485-608             AC092653.3         183933-184056       c
            609-669             AC092653.3         179398-179458       c
            670-716             AC092653.3         177294-177340       c
            717-792             AC092653.3         176961-177036       c
            793-969             AC092653.3         176551-176727       c
            970-1616            AC092653.3         172346-172992       c
FEATURES             Location/Qualifiers
     source          1..1616
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="2"
                     /map="2p13.1"
     gene            1..1616
                     /gene="DUSP11"
                     /gene_synonym="PIR1"
                     /note="dual specificity phosphatase 11"
                     /db_xref="GeneID:8446"
                     /db_xref="HGNC:HGNC:3066"
                     /db_xref="MIM:603092"
     exon            1..276
                     /gene="DUSP11"
                     /gene_synonym="PIR1"
                     /inference="alignment:Splign:2.1.0"
     CDS             35..1168
                     /gene="DUSP11"
                     /gene_synonym="PIR1"
                     /EC_number="3.1.3.16"
                     /EC_number="3.1.3.48"
                     /note="isoform 2 is encoded by transcript variant 2;
                     serine/threonine specific protein phosphatase; RNA/RNP
                     complex-interacting phosphatase; RNA/RNP
                     complex-1-interacting phosphatase; dual specificity
                     protein phosphatase 11; phosphatase that interacts with
                     RNA/RNP complex 1; RNA/RNP complex 1-interacting"
                     /codon_start=1
                     /product="RNA/RNP complex-1-interacting phosphatase
                     isoform 2"
                     /protein_id="NP_001411578.1"
                     /db_xref="GeneID:8446"
                     /db_xref="HGNC:HGNC:3066"
                     /db_xref="MIM:603092"
                     /translation="

MRNSETLERGVGGCRVFSCLGSYPGIEGAGLALLADLALGGRLLGTHMSQWHHPRSGWGRRRDFSGRSSAKKKGGNHIPERWKDYLPVGQRMPGTRFIAFKVPLQKSFEKKLAPEECFSPLDLFNKIREQNEELGLIIDLTYTQRYYKPEDLPETVPYLKIFTVGHQVPDDETIFKFKHAVNGFLKENKDNDKLIGVHCTHGLNRTGYLICRYLIDVEGVRPDDAIELFNRCRGHCLERQNYIEDLQNGPIRKNWNSSVPRSSDFEDSAHLMQPVHNKPVKQGPRYNLHQIQGHSAPRHFHTQTQSLQQSVRKFSENPHVYQRHHLPPPGPPGEDYSHRRYSWNVKPNASRAAQDRRRWYPYNYSRLSYPACWEWTQ"

     misc_feature    275..778
                     /gene="DUSP11"
                     /gene_synonym="PIR1"
                     /note="dual-specificity phosphatase domain of dual
                     specificity protein phosphatase 11 and similar proteins;
                     Region: DSP_DUSP11; cd17665"
                     /db_xref="CDD:350503"
     exon            277..352
                     /gene="DUSP11"
                     /gene_synonym="PIR1"
                     /inference="alignment:Splign:2.1.0"
     exon            353..484
                     /gene="DUSP11"
                     /gene_synonym="PIR1"
                     /inference="alignment:Splign:2.1.0"
     exon            485..608
                     /gene="DUSP11"
                     /gene_synonym="PIR1"
                     /inference="alignment:Splign:2.1.0"
     exon            609..669
                     /gene="DUSP11"
                     /gene_synonym="PIR1"
                     /inference="alignment:Splign:2.1.0"
     exon            670..716
                     /gene="DUSP11"
                     /gene_synonym="PIR1"
                     /inference="alignment:Splign:2.1.0"
     exon            717..792
                     /gene="DUSP11"
                     /gene_synonym="PIR1"
                     /inference="alignment:Splign:2.1.0"
     exon            793..969
                     /gene="DUSP11"
                     /gene_synonym="PIR1"
                     /inference="alignment:Splign:2.1.0"
     exon            970..1616
                     /gene="DUSP11"
                     /gene_synonym="PIR1"
                     /inference="alignment:Splign:2.1.0"
     regulatory      1594..1599
                     /regulatory_class="polyA_signal_sequence"
                     /gene="DUSP11"
                     /gene_synonym="PIR1"
                     /note="hexamer: ATTAAA"
     polyA_site      1616
                     /gene="DUSP11"
                     /gene_synonym="PIR1"
                     /note="major polyA site"
ORIGIN      

agcgtggctacgccatcacgaccggcggtggcacatgcgcaatagcgagacgctggagcgcggcgtaggtggctgccgagtcttttcctgtttagggtcttatcctggcattgagggcgccggactggcgcttttggccgacttggcattgggtgggcggcttcttgggacccacatgagccagtggcatcatccccgcagtggctggggccggagacgcgacttttcaggacgctcctcagccaagaagaagggcggaaaccacatccccgaaaggtggaaagactatctcccagttggacagcggatgcctgggactcgtttcattgctttcaaagttcctttgcaaaagagttttgaaaagaaacttgctccagaagaatgcttttcccctttggatctttttaacaaaatccgagaacaaaatgaagaacttggactgattattgatttaacatatactcaacgctattataaaccagaggatttgccagaaactgttccttacttaaaaatttttacagttggacatcaagtgcctgatgatgagactatttttaaattcaaacacgctgttaatgggtttttgaaagaaaataaagataatgataaacttattggtgtccactgtacccatggtttaaacaggactggctacctcatttgcagatatttgattgatgtagaaggcgtgaggccagatgatgcaattgaattattcaataggtgccggggacattgcttagaaagacaaaactacattgaagaccttcagaatggtcctatcagaaagaattggaattccagtgtacccaggtcaagtgattttgaagactcagcacatctcatgcaaccagtccacaataagcctgttaaacaaggacctaggtataatctacatcagatccagggtcactcagctcctcgacatttccacacccagacccaaagtttgcaacaatcagtcagaaaattttcagagaatccacatgtttaccagagacaccatctccctcctcctggtccccctggagaggactattcacacaggaggtattcttggaatgtgaagcccaatgccagtcgggcagcccaggatagaagaaggtggtatccttataattactccagactctcctatccagcctgttgggaatggacccagtgatacaaacctgtcctggaattctacctggagaccagagctggcctgaaaattactggtgtgacttttaattagttcaggtctaatcaggtttctttattgttcccttatgtattcaagcttaaggaaaaattgcattgctgtttacctctttgctgataaatttgcagtaattacagcattgcaggaaaaacaatctgttattccagtcttaaatttttctaaaagaagacaatattttagaactgaagcattgagaacttcccttgcaaattatttttaaaattctatcttgtttttctatgtatttctttctgactagacttgtgatatgcgtgtgtttatgtacagaaatttttagtgtttttgttatgttctgttattgacccaaaggccatctttattttctataactgttcaaaatttatattaaaatctacttaggagataa

//