2025-07-15 21:27:53, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_001411001 2018 bp mRNA linear PRI 22-SEP-2024 DEFINITION Homo sapiens nucleoporin 58 (NUP58), transcript variant 3, mRNA. ACCESSION NM_001411001 XM_011535328 VERSION NM_001411001.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 2018) AUTHORS Targa,A., Larrimore,K.E., Wong,C.K., Chong,Y.L., Fung,R., Lee,J., Choi,H. and Rancati,G. TITLE Non-genetic and genetic rewiring underlie adaptation to hypomorphic alleles of an essential gene JOURNAL EMBO J 40 (21), e107839 (2021) PUBMED 34528284 REMARK GeneRIF: Non-genetic and genetic rewiring underlie adaptation to hypomorphic alleles of an essential gene. REFERENCE 2 (bases 1 to 2018) AUTHORS Huttlin,E.L., Bruckner,R.J., Navarrete-Perea,J., Cannon,J.R., Baltier,K., Gebreab,F., Gygi,M.P., Thornock,A., Zarraga,G., Tam,S., Szpyt,J., Gassaway,B.M., Panov,A., Parzen,H., Fu,S., Golbazi,A., Maenpaa,E., Stricker,K., Guha Thakurta,S., Zhang,T., Rad,R., Pan,J., Nusinow,D.P., Paulo,J.A., Schweppe,D.K., Vaites,L.P., Harper,J.W. and Gygi,S.P. TITLE Dual proteome-scale networks reveal cell-specific remodeling of the human interactome JOURNAL Cell 184 (11), 3022-3040 (2021) PUBMED 33961781 REFERENCE 3 (bases 1 to 2018) AUTHORS Haenig,C., Atias,N., Taylor,A.K., Mazza,A., Schaefer,M.H., Russ,J., Riechers,S.P., Jain,S., Coughlin,M., Fontaine,J.F., Freibaum,B.D., Brusendorf,L., Zenkner,M., Porras,P., Stroedicke,M., Schnoegl,S., Arnsburg,K., Boeddrich,A., Pigazzini,L., Heutink,P., Taylor,J.P., Kirstein,J., Andrade-Navarro,M.A., Sharan,R. and Wanker,E.E. TITLE Interactome Mapping Provides a Network of Neurodegenerative Disease Proteins and Uncovers Widespread Protein Aggregation in Affected Brains JOURNAL Cell Rep 32 (7), 108050 (2020) PUBMED 32814053 REFERENCE 4 (bases 1 to 2018) AUTHORS Luck,K., Kim,D.K., Lambourne,L., Spirohn,K., Begg,B.E., Bian,W., Brignall,R., Cafarelli,T., Campos-Laborie,F.J., Charloteaux,B., Choi,D., Cote,A.G., Daley,M., Deimling,S., Desbuleux,A., Dricot,A., Gebbia,M., Hardy,M.F., Kishore,N., Knapp,J.J., Kovacs,I.A., Lemmens,I., Mee,M.W., Mellor,J.C., Pollis,C., Pons,C., Richardson,A.D., Schlabach,S., Teeking,B., Yadav,A., Babor,M., Balcha,D., Basha,O., Bowman-Colin,C., Chin,S.F., Choi,S.G., Colabella,C., Coppin,G., D'Amata,C., De Ridder,D., De Rouck,S., Duran-Frigola,M., Ennajdaoui,H., Goebels,F., Goehring,L., Gopal,A., Haddad,G., Hatchi,E., Helmy,M., Jacob,Y., Kassa,Y., Landini,S., Li,R., van Lieshout,N., MacWilliams,A., Markey,D., Paulson,J.N., Rangarajan,S., Rasla,J., Rayhan,A., Rolland,T., San-Miguel,A., Shen,Y., Sheykhkarimli,D., Sheynkman,G.M., Simonovsky,E., Tasan,M., Tejeda,A., Tropepe,V., Twizere,J.C., Wang,Y., Weatheritt,R.J., Weile,J., Xia,Y., Yang,X., Yeger-Lotem,E., Zhong,Q., Aloy,P., Bader,G.D., De Las Rivas,J., Gaudet,S., Hao,T., Rak,J., Tavernier,J., Hill,D.E., Vidal,M., Roth,F.P. and Calderwood,M.A. TITLE A reference map of the human binary protein interactome JOURNAL Nature 580 (7803), 402-408 (2020) PUBMED 32296183 REFERENCE 5 (bases 1 to 2018) AUTHORS Fragoza,R., Das,J., Wierbowski,S.D., Liang,J., Tran,T.N., Liang,S., Beltran,J.F., Rivera-Erick,C.A., Ye,K., Wang,T.Y., Yao,L., Mort,M., Stenson,P.D., Cooper,D.N., Wei,X., Keinan,A., Schimenti,J.C., Clark,A.G. and Yu,H. TITLE Extensive disruption of protein interactions by genetic variants across the allele frequency spectrum in human populations JOURNAL Nat Commun 10 (1), 4141 (2019) PUBMED 31515488 REMARK Publication Status: Online-Only REFERENCE 6 (bases 1 to 2018) AUTHORS Kaltenbach,L.S., Romero,E., Becklin,R.R., Chettier,R., Bell,R., Phansalkar,A., Strand,A., Torcassi,C., Savage,J., Hurlburt,A., Cha,G.H., Ukani,L., Chepanoske,C.L., Zhen,Y., Sahasrabudhe,S., Olson,J., Kurschner,C., Ellerby,L.M., Peltier,J.M., Botas,J. and Hughes,R.E. TITLE Huntingtin interacting proteins are genetic modifiers of neurodegeneration JOURNAL PLoS Genet 3 (5), e82 (2007) PUBMED 17500595 REFERENCE 7 (bases 1 to 2018) AUTHORS Le Rouzic,E., Mousnier,A., Rustum,C., Stutz,F., Hallberg,E., Dargemont,C. and Benichou,S. TITLE Docking of HIV-1 Vpr to the nuclear envelope is mediated by the interaction with the nucleoporin hCG1 JOURNAL J Biol Chem 277 (47), 45091-45098 (2002) PUBMED 12228227 REFERENCE 8 (bases 1 to 2018) AUTHORS Ben-Efraim,I. and Gerace,L. TITLE Gradient of increasing affinity of importin beta for nucleoporins along the pathway of nuclear import JOURNAL J Cell Biol 152 (2), 411-417 (2001) PUBMED 11266456 REFERENCE 9 (bases 1 to 2018) AUTHORS Shiota,C., Coffey,J., Grimsby,J., Grippo,J.F. and Magnuson,M.A. TITLE Nuclear import of hepatic glucokinase depends upon glucokinase regulatory protein, whereas export is due to a nuclear export signal sequence in glucokinase JOURNAL J Biol Chem 274 (52), 37125-37130 (1999) PUBMED 10601273 REFERENCE 10 (bases 1 to 2018) AUTHORS Buss,F. and Stewart,M. TITLE Macromolecular interactions in the nucleoporin p62 complex of rat nuclear pores: binding of nucleoporin p54 to the rod domain of p62 JOURNAL J Cell Biol 128 (3), 251-261 (1995) PUBMED 7531196 REMARK GeneRIF: The human gene NUPL1 shares 87% sequence identity with rat nucleoporin p58. COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AL590787.24, AL646102.4 and AL138958.18. On Aug 20, 2022 this sequence version replaced XM_011535328.3. Summary: This gene encodes a member of the nucleoporin family that shares 87% sequence identity with rat nucleoporin p58. The protein is localized to the nuclear rim and is a component of the nuclear pore complex (NPC). All molecules entering or leaving the nucleus either diffuse through or are actively transported by the NPC. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: SRR5189667.370200.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA1968968, SAMEA2148093 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-256 AL590787.24 86900-87155 257-399 AL590787.24 93081-93223 400-435 AL590787.24 94522-94557 436-585 AL590787.24 98158-98307 586-723 AL590787.24 98889-99026 724-834 AL590787.24 100632-100742 835-859 AL590787.24 104601-104625 860-925 AL590787.24 105805-105870 926-1100 AL590787.24 106194-106368 1101-1180 AL590787.24 110264-110343 1181-1299 AL590787.24 112191-112309 1300-1382 AL590787.24 112705-112787 1383-1584 AL590787.24 116632-116833 1585-1683 AL590787.24 122211-122309 1684-1779 AL646102.4 3322-3417 1780-2018 AL138958.18 12252-12490 FEATURES Location/Qualifiers source 1..2018 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="13" /map="13q12.13" gene 1..2018 /gene="NUP58" /gene_synonym="NUP45; NUPL1; PRO2463" /note="nucleoporin 58" /db_xref="GeneID:9818" /db_xref="HGNC:HGNC:20261" /db_xref="MIM:607615" exon 1..256 /gene="NUP58" /gene_synonym="NUP45; NUPL1; PRO2463" /inference="alignment:Splign:2.1.0" misc_feature 87..89 /gene="NUP58" /gene_synonym="NUP45; NUPL1; PRO2463" /note="upstream in-frame stop codon" CDS 150..1862 /gene="NUP58" /gene_synonym="NUP45; NUPL1; PRO2463" /note="isoform c is encoded by transcript variant 3; nucleoporin p58/p45; nucleoporin-like protein 1; nucleoporin like 1; 58 kDa nucleoporin; nucleoporin 58kDa" /codon_start=1 /product="nucleoporin p58/p45 isoform c" /protein_id="NP_001397930.1" /db_xref="CCDS:CCDS91790.1" /db_xref="GeneID:9818" /db_xref="HGNC:HGNC:20261" /db_xref="MIM:607615" /translation="
MSTGFSFGSGTLGSTTVAAGGTSTGGVFSFGTGASSNPSVGLNFGNLGSTSTPATTSAPSSGFGTGLFGSKPATGFTLGGTNTGIATTITTGLTLGTPATTSAATTGFSLGFNKPAASATPFALPITSTSASGLTLSSALTSTPAASTGFTLNNLGGTTATTTTASTGLSLGGALAGLGGSLFQSTNTGTSGLGQNALGLTLGTTAATSTAGNEGLGGIDFSSSSDKKSDKTGTRPEDSKALKDENLPPVICQDVENLQKFVKEQKQVQEEISRMSSKAMLKVQEDIKALKQLLSLAANGIQRNTLNIDKLKIETAQELKNAEIALRTQKTPPGLQHEYAAPADYFRILVQQFEVQLQQYRQQIEELENHLATQANNSHITPQDLSMAMQKIYQTFVALAAQLQSIHENVKVLKEQYLGYRKMFLGDAVDVFETRRAEAKKWQNTPRVTTGPTPFSTMPNAAAVAMAATLTQQQQPATGPQPSLGVSFGTPFGSGIGTGLQSSGLGSSNLGGFGTSSGFGCSTTGASTFGFGTTNKPSGSLSAGNKSQVLTEFRKPSVTETNEIGRKIQF"
misc_feature 156..1808 /gene="NUP58" /gene_synonym="NUP45; NUPL1; PRO2463" /note="Nucleoporin FG repeated region; Region: Nucleoporin_FG2; pfam15967" /db_xref="CDD:435043" exon 257..399 /gene="NUP58" /gene_synonym="NUP45; NUPL1; PRO2463" /inference="alignment:Splign:2.1.0" exon 400..435 /gene="NUP58" /gene_synonym="NUP45; NUPL1; PRO2463" /inference="alignment:Splign:2.1.0" exon 436..585 /gene="NUP58" /gene_synonym="NUP45; NUPL1; PRO2463" /inference="alignment:Splign:2.1.0" exon 586..723 /gene="NUP58" /gene_synonym="NUP45; NUPL1; PRO2463" /inference="alignment:Splign:2.1.0" exon 724..834 /gene="NUP58" /gene_synonym="NUP45; NUPL1; PRO2463" /inference="alignment:Splign:2.1.0" exon 835..859 /gene="NUP58" /gene_synonym="NUP45; NUPL1; PRO2463" /inference="alignment:Splign:2.1.0" exon 860..925 /gene="NUP58" /gene_synonym="NUP45; NUPL1; PRO2463" /inference="alignment:Splign:2.1.0" exon 926..1100 /gene="NUP58" /gene_synonym="NUP45; NUPL1; PRO2463" /inference="alignment:Splign:2.1.0" exon 1101..1180 /gene="NUP58" /gene_synonym="NUP45; NUPL1; PRO2463" /inference="alignment:Splign:2.1.0" exon 1181..1299 /gene="NUP58" /gene_synonym="NUP45; NUPL1; PRO2463" /inference="alignment:Splign:2.1.0" exon 1300..1382 /gene="NUP58" /gene_synonym="NUP45; NUPL1; PRO2463" /inference="alignment:Splign:2.1.0" exon 1383..1584 /gene="NUP58" /gene_synonym="NUP45; NUPL1; PRO2463" /inference="alignment:Splign:2.1.0" exon 1585..1683 /gene="NUP58" /gene_synonym="NUP45; NUPL1; PRO2463" /inference="alignment:Splign:2.1.0" exon 1684..1779 /gene="NUP58" /gene_synonym="NUP45; NUPL1; PRO2463" /inference="alignment:Splign:2.1.0" exon 1780..2018 /gene="NUP58" /gene_synonym="NUP45; NUPL1; PRO2463" /inference="alignment:Splign:2.1.0" regulatory 1988..1993 /regulatory_class="polyA_signal_sequence" /gene="NUP58" /gene_synonym="NUP45; NUPL1; PRO2463" /note="hexamer: AATAAA" polyA_site 2018 /gene="NUP58" /gene_synonym="NUP45; NUPL1; PRO2463" /note="major polyA site" ORIGIN
agccttgccttcgccgccgttggggctggaagttcccgccaggtccgtgccgggcgagagagatgctgcccggcccgcctcggctttgaggcgagagaagtgtcccagacccatttcgccttgctgacggcgtcgagccctggccagacatgtccacagggttctccttcgggtccgggactctgggctccaccaccgtggccgccggcgggaccagcacaggcggcgttttctccttcggaacgggagcgtctagcaacccttctgtggggctcaattttggaaatcttggaagtacttcaactccagcaactacatctgctccttcaagtggttttggaaccgggctctttggatctaaacctgccactgggttcactctaggaggaacaaatacaggaatagcaacaactataactacaggattaactctgggaacgccagccactacatctgcagctacaacaggcttcagtttaggattcaataaacctgcagcatctgccacaccatttgctctacctattacctctacctcagctagcggtctgactctttcgtctgctctgacatcaactccagcagcatccacaggatttactctaaataatttgggtgggacaacagccacaactacaactgcatcaacaggcctctctttagggggagccttagctggtttgggaggttcacttttccagagtacaaacacaggaacatcaggacttggacagaatgctttagggttgactttgggaactacagcagctacttcaactgcaggcaatgaaggccttggtggtatagatttcagtagctcctcagataaaaagagtgataaaacgggaacaagaccagaggatagtaaagctctgaaggatgaaaatctacctcctgtcatctgccaggatgttgaaaatctccagaaatttgtgaaggagcagaaacaagttcaagaagaaattagtagaatgtcttcaaaagcaatgcttaaggtacaagaagatattaaagctctgaagcagctcctgtcgttggctgccaatggaatacagagaaacactctcaacattgacaaattgaaaatagaaactgctcaggagttgaagaatgctgaaatagctttaagaacccagaagacaccacctggacttcaacatgaatatgcagctcctgctgactacttcagaatcttggttcagcaatttgaggtacagcttcagcagtacaggcagcagattgaagaactagaaaaccatcttgccactcaagcaaataattcacatataacccctcaagatttgtcaatggctatgcagaaaatttatcaaacatttgtagctttagcggcacaacttcagtctattcatgaaaatgtaaaggttctgaaagaacagtaccttggctacaggaaaatgttcttgggagatgctgttgatgtgtttgaaacaaggcgagcagaagccaagaagtggcagaacacacccagagttactactggacccactcctttcagcaccatgccaaacgcagcagccgttgccatggctgcaacacttacacagcagcaacagcctgctacagggccacagccatctctgggagttagttttggaacgccattcggctcaggtattggcactggcttgcaatcaagtggcttaggttcttcaaaccttggaggatttggaactagctctggttttggatgcagcaccacaggggcctccacatttggatttggaacaacaaataaaccctcaggaagtcttagtgcaggcaacaaatcacaggttttaactgaatttcgaaaacccagtgttacagaaaccaatgaaataggaagaaaaatacagttctgagcagtccttgaatcaacaaatatctacctttaaggaacttctaattctcattttgtaaatcccattattcaagaaaagcacattaagcttagagtaggtttgatcaagatgtttagaattaaggaaataaaacttgcctttggtgtttaaggacaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]