2025-07-15 19:38:33, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_001410999 1775 bp mRNA linear PRI 05-OCT-2024 DEFINITION Homo sapiens transmembrane protein 138 (TMEM138), transcript variant 6, mRNA. ACCESSION NM_001410999 XM_006718585 VERSION NM_001410999.1 KEYWORDS RefSeq. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1775) AUTHORS Guo,D., Ru,J., Xie,L., Wu,M., Su,Y., Zhu,S., Xu,S., Zou,B., Wei,Y., Liu,X., Liu,Y. and Liu,C. TITLE Tmem138 is localized to the connecting cilium essential for rhodopsin localization and outer segment biogenesis JOURNAL Proc Natl Acad Sci U S A 119 (15), e2109934119 (2022) PUBMED 35394880 REMARK GeneRIF: Tmem138 is localized to the connecting cilium essential for rhodopsin localization and outer segment biogenesis. REFERENCE 2 (bases 1 to 1775) AUTHORS Bizzari,S., Hamzeh,A.R., Nair,P., Mohamed,M. and Bastaki,F. TITLE Characterization of an Emirati TMEM138 mutation leading to Joubert syndrome JOURNAL Pediatr Int 59 (1), 113-114 (2017) PUBMED 28102635 REMARK GeneRIF: Here we present clinical and molecular characterization of the case of an Emirati boy with Joubert syndrome, probably resulting from a splice-site mutation in TMEM138 REFERENCE 3 (bases 1 to 1775) AUTHORS Li,C., Jensen,V.L., Park,K., Kennedy,J., Garcia-Gonzalo,F.R., Romani,M., De Mori,R., Bruel,A.L., Gaillard,D., Doray,B., Lopez,E., Riviere,J.B., Faivre,L., Thauvin-Robinet,C., Reiter,J.F., Blacque,O.E., Valente,E.M. and Leroux,M.R. TITLE MKS5 and CEP290 Dependent Assembly Pathway of the Ciliary Transition Zone JOURNAL PLoS Biol 14 (3), e1002416 (2016) PUBMED 26982032 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 1775) AUTHORS Venkatesh,B., Ravi,V., Lee,A.P., Warren,W.C. and Brenner,S. TITLE Basal vertebrates clarify the evolutionary history of ciliopathy-associated genes Tmem138 and Tmem216 JOURNAL Mol Biol Evol 30 (1), 62-65 (2013) PUBMED 22936720 REFERENCE 5 (bases 1 to 1775) AUTHORS Lee,J.H., Silhavy,J.L., Lee,J.E., Al-Gazali,L., Thomas,S., Davis,E.E., Bielas,S.L., Hill,K.J., Iannicelli,M., Brancati,F., Gabriel,S.B., Russ,C., Logan,C.V., Sharif,S.M., Bennett,C.P., Abe,M., Hildebrandt,F., Diplas,B.H., Attie-Bitach,T., Katsanis,N., Rajab,A., Koul,R., Sztriha,L., Waters,E.R., Ferro-Novick,S., Woods,C.G., Johnson,C.A., Valente,E.M., Zaki,M.S. and Gleeson,J.G. TITLE Evolutionarily assembled cis-regulatory module at a human ciliopathy locus JOURNAL Science 335 (6071), 966-969 (2012) PUBMED 22282472 REMARK GeneRIF: study reports that mutation of either TMEM138 or TMEM216 causes a phenotypically indistinguishable ciliopathy, Joubert syndrome; expression of the genes is mediated by a conserved regulatory element in the noncoding intergenic region REFERENCE 6 (bases 1 to 1775) AUTHORS Wang,A.G., Yoon,S.Y., Oh,J.H., Jeon,Y.J., Kim,M., Kim,J.M., Byun,S.S., Yang,J.O., Kim,J.H., Kim,D.G., Yeom,Y.I., Yoo,H.S., Kim,Y.S. and Kim,N.S. TITLE Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags JOURNAL Biochem Biophys Res Commun 345 (3), 1022-1032 (2006) PUBMED 16712791 REFERENCE 7 (bases 1 to 1775) AUTHORS Gunay-Aygun,M., Gahl,W.A. and Heller,T. TITLE Congenital Hepatic Fibrosis Overview horizontal line RETIRED CHAPTER, FOR HISTORICAL REFERENCE ONLY JOURNAL (in) Adam MP, Feldman J, Mirzaa GM, Pagon RA, Wallace SE and Amemiya A (Eds.); GENEREVIEWS(R); (1993) PUBMED 20301743 REFERENCE 8 (bases 1 to 1775) AUTHORS Parisi,M. and Glass,I. TITLE Joubert Syndrome JOURNAL (in) Adam MP, Feldman J, Mirzaa GM, Pagon RA, Wallace SE and Amemiya A (Eds.); GENEREVIEWS(R); (1993) PUBMED 20301500 COMMENT REVIEWED REFSEQ: This record has been curated by NCBI staff. The reference sequence was derived from AP003108.3. On Aug 20, 2022 this sequence version replaced XM_006718585.4. Summary: This gene encodes a multi-pass transmembrane protein. Reduced expression of this gene in mouse fibroblasts causes short cilia and failure of ciliogenesis. Expression of this gene is tightly coordinated with expression of the neighboring gene TMEM216. Mutations in this gene are associated with the autosomal recessive neurodevelopmental disorder Joubert Syndrome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2012]. ##Evidence-Data-START## Transcript exon combination :: SRR14038194.1243397.1, SRR14038192.108087.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA1965299, SAMEA1966682 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-47 AP003108.3 34562-34608 48-314 AP003108.3 36440-36706 315-486 AP003108.3 38233-38404 487-1775 AP003108.3 40111-41399 FEATURES Location/Qualifiers source 1..1775 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="11" /map="11q12.2" gene 1..1775 /gene="TMEM138" /gene_synonym="HSPC196" /note="transmembrane protein 138" /db_xref="GeneID:51524" /db_xref="HGNC:HGNC:26944" /db_xref="MIM:614459" exon 1..47 /gene="TMEM138" /gene_synonym="HSPC196" /inference="alignment:Splign:2.1.0" exon 48..314 /gene="TMEM138" /gene_synonym="HSPC196" /inference="alignment:Splign:2.1.0" misc_feature 58..60 /gene="TMEM138" /gene_synonym="HSPC196" /note="upstream in-frame stop codon" CDS 187..720 /gene="TMEM138" /gene_synonym="HSPC196" /note="isoform 5 is encoded by transcript variant 6" /codon_start=1 /product="transmembrane protein 138 isoform 5" /protein_id="NP_001397928.1" /db_xref="CCDS:CCDS91484.1" /db_xref="GeneID:51524" /db_xref="HGNC:HGNC:26944" /db_xref="MIM:614459" /translation="
MLQTSNYSLVLSLQFLLLSYDLFVNSFSELLQKTPVIQLVLFIIQDIAVLFNIIIIFLMFFNTFVFQAGLVNLLFHKFKGTIILTAVYFALSISLHVWVMNLRWKNSNSFIWTDGLQMLFVFQRLGKDQSKVRPLSGPTCVSFSEGLDAGFPDLSQLAWDGCDSHTRNRRDYCPCPC"
misc_feature 202..204 /gene="TMEM138" /gene_synonym="HSPC196" /note="N-linked (GlcNAc...) asparagine. /evidence=ECO:0000255; propagated from UniProtKB/Swiss-Prot (Q9NPI0.1); glycosylation site" misc_feature 205..267 /gene="TMEM138" /gene_synonym="HSPC196" /note="propagated from UniProtKB/Swiss-Prot (Q9NPI0.1); transmembrane region" misc_feature 298..>564 /gene="TMEM138" /gene_synonym="HSPC196" /note="Transmembrane protein 138; Region: TMEM138; pfam14935" /db_xref="CDD:434328" misc_feature 307..369 /gene="TMEM138" /gene_synonym="HSPC196" /note="propagated from UniProtKB/Swiss-Prot (Q9NPI0.1); transmembrane region" misc_feature 424..486 /gene="TMEM138" /gene_synonym="HSPC196" /note="propagated from UniProtKB/Swiss-Prot (Q9NPI0.1); transmembrane region" exon 315..486 /gene="TMEM138" /gene_synonym="HSPC196" /inference="alignment:Splign:2.1.0" exon 487..1775 /gene="TMEM138" /gene_synonym="HSPC196" /inference="alignment:Splign:2.1.0" regulatory 1750..1755 /regulatory_class="polyA_signal_sequence" /gene="TMEM138" /gene_synonym="HSPC196" /note="hexamer: AATAAA" polyA_site 1775 /gene="TMEM138" /gene_synonym="HSPC196" /note="major polyA site" ORIGIN
ggaagccgggacgatgtccgcatgacaaccgacgttggagtttggaggtgcttgccttagagcaagggaaacagctctcattcaaaggaactagaagcctctccctcagtggtagggagacagccaggagcggttttctgggaactgtgggatgtgcccttgggggcccgagaaaacagaaggaagatgctccagaccagtaactacagcctggtgctctctctgcagttcctgctgctgtcctatgacctctttgtcaattccttctcagaactgctccaaaagactcctgtcatccagcttgtgctcttcatcatccaggatattgcagtcctcttcaacatcatcatcattttcctcatgttcttcaacaccttcgtcttccaggctggcctggtcaacctcctattccataagttcaaagggaccatcatcctgacagctgtgtactttgccctcagcatctcccttcatgtctgggtcatgaacttacgctggaaaaactccaacagcttcatatggacagatggacttcaaatgctgtttgtattccagagactaggtaaggaccagagcaaggtcaggcctctctcaggtcccacatgtgtctctttcagtgagggccttgatgctggcttcccagacctgtcccagctggcttgggatggttgtgacagccacaccaggaacaggagggattactgcccctgcccttgctagaagactatgggaaatgaggaggcagggctgcccagcctcattaggttctgttctttttgtttgtttgtttgtttgtttgtttgtttttgagacagtcttgctctgtcgcccaggctggagtgctgtggcgctatctcaggctcactgcaagctccgcctcccgggttcacaccattctcctgcctcagcctccggagtagctgggactacaggcgcccgccaccacgcccagctaattttttgtgtatttttagtagagacagggtttcaccgtgttagccaggatggtctcgatctctgacctcatgatccgcctgcctctgcctcctaaagtgctgggattacaggcgtgagccaccacgcctggccaggttctgttcttaacctgaaatgatactcaggagcacccctgaggcttctcttctgcttcctccccacagcagcagtgttgtactgctacttctataaacggacagccgtaagactaggcgatcctcacttctaccaggactctttgtggctgcgcaaggagttcatgcaagttcgaaggtgacctcttgtcacactgatggatacttttccttcctgatagaagccacatttgctgctttgcagggagagttggccctatgcatgggcaaacagctggactttccaaggaaggttcagactagctgtgttcagcattcaagaaggaagatcctccctcttgcacaattagagtgtccccatcggtctccagtgcggcatcccttccttgccttctacctctgttccaccccctttccttcctttcctctctgtaccattcattctccctgaccggcctttcttgccgagggttctgtggctcttacccttgtgaagcttttcctttagcctgggacagaaggacctcccagcccccaaaggatctcccagtgaccaaaggatgcgaagagtgatagttacgtgctcctgactgatcacaccgcagacatttagatttttatacccaaggcactttaaaaaaatgttttataaatagagaataaattgaattcttgttccataaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]