2025-06-17 07:15:04, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_001397445 1299 bp mRNA linear PRI 17-NOV-2021 DEFINITION Homo sapiens inward rectifying K+ channel negative regulator Kir2.2v (KCNJ17), mRNA. ACCESSION NM_001397445 VERSION NM_001397445.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 1299) AUTHORS Paninka RM, Mazzotti DR, Kizys MM, Vidi AC, Rodrigues H, Silva SP, Kunii IS, Furuzawa GK, Arcisio-Miranda M and Dias-da-Silva MR. TITLE Whole genome and exome sequencing realignment supports the assignment of KCNJ12, KCNJ17, and KCNJ18 paralogous genes in thyrotoxic periodic paralysis locus: functional characterization of two polymorphic Kir2.6 isoforms JOURNAL Mol Genet Genomics 291 (4), 1535-1544 (2016) PUBMED 27008341 REFERENCE 2 (bases 1 to 1299) AUTHORS Namba N, Mori R, Tanaka H, Kondo I, Narahara K and Seino Y. TITLE The inwardly rectifying potassium channel subunit Kir2.2v (KCNJN1) maps to 17p11.2-->p11.1 JOURNAL Cytogenet Cell Genet 79 (1-2), 85-87 (1997) PUBMED 9533018 REFERENCE 3 (bases 1 to 1299) AUTHORS Namba N, Inagaki N, Gonoi T, Seino Y and Seino S. TITLE Kir2.2v: a possible negative regulator of the inwardly rectifying K+ channel Kir2.2 JOURNAL FEBS Lett 386 (2-3), 211-214 (1996) PUBMED 8647284 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from CP068261.2. ##RefSeq-Attributes-START## RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1299 CP068261.2 22666291-22667589 c FEATURES Location/Qualifiers source 1..1299 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="17" gene 1..1299 /gene="KCNJ17" /gene_synonym="KCNJN1; Kir2.2v; Kir2.5" /note="inward rectifying K+ channel negative regulator Kir2.2v" /db_xref="GeneID:123464521" CDS 1..1299 /gene="KCNJ17" /gene_synonym="KCNJN1; Kir2.2v; Kir2.5" /note="potassium inwardly-rectifying channel, subfamily J, inhibitor 1" /codon_start=1 /product="inward rectifying K+ channel negative regulator Kir2.2v" /protein_id="NP_001384374.1" /db_xref="GeneID:123464521" /translation="
MTAASRANPYSIVSSEEDGLHLVTMSGANGFGNGKLHTRRRCHNRFVKKNGQCNIEFANMDEKSQRYLADIFTTCVDIRWRYMLLIFSLAFLASWLLFGVIFWVIAVAHGDLEPAEGRGRTPCVMQVHGFMAAFLFSIKTQTTISYGLRCVTEECPVAVFMVVAQSIVGCIINSFMIGAIMAKMVRPKKRAQTLLFSHNAVVALRDGKLCFMWRVGNLRKSHIVEAHVRAQLIKPRVTEEGEYIPLDQIDIDVGFDKGLDHSFLVSPITILHEIDEASPLFGISRQDLQMDDFEIVIILEGIVEATAMTTQARSSYLANEILWGHRFEPVLFEKNQYKIDYLHFHKTYEVPSTPRCSAKDLVENKFLLPRANSFCYKNELAFLSRDEEDEADGDQDGRSREGLIPQARHDFDRLQAGGGVLEQRPYRRESEI"
misc_feature 4..138 /gene="KCNJ17" /gene_synonym="KCNJN1; Kir2.2v; Kir2.5" /note="Inward rectifier potassium channel N-terminal; Region: IRK_N; pfam08466" /db_xref="CDD:462486" misc_feature 139..561 /gene="KCNJ17" /gene_synonym="KCNJN1; Kir2.2v; Kir2.5" /note="Inward rectifier potassium channel transmembrane domain; Region: IRK; pfam01007" /db_xref="CDD:460023" misc_feature 580..1095 /gene="KCNJ17" /gene_synonym="KCNJN1; Kir2.2v; Kir2.5" /note="Inward rectifier potassium channel C-terminal domain; Region: IRK_C; pfam17655" /db_xref="CDD:465439" ORIGIN
atgaccgcagccagccgggccaacccctacagcatcgtgtcatcggaggaggacgggctgcacctggtcaccatgtcgggcgccaatggcttcggcaacggcaagttgcacacgcggcgcaggtgccacaaccgcttcgtcaagaagaatggccagtgcaacattgagttcgccaacatggacgagaagtcacagcgctacctggctgacatattcaccacctgtgtggacatccgctggcggtacatgctgctcatcttctcactggccttccttgcctcctggctgctgtttggtgtcatcttctgggtcattgcggtggcacatggtgacctggagccggctgagggccgcggccgcacaccctgtgtgatgcaggtgcacggcttcatggcggccttcctcttctccatcaagacgcagaccaccatcagctacgggctgcgctgtgtgacagaggagtgcccggtggccgtcttcatggtggtggcccagtccatcgtgggctgcatcatcaactccttcatgattggtgccatcatggccaagatggtaaggcccaagaagcgggcacagacgctgctgttcagccacaatgccgtggtggccctgcgtgatggcaagctctgcttcatgtggcgtgtgggcaacctgcgtaagagccacattgtggaggcccatgtgcgcgcgcagctcatcaagccgcgggtcaccgaggagggcgagtacatcccgctagaccagatcgacatcgatgtgggcttcgacaagggcctggaccacagctttctggtgtcacccatcaccatcctgcacgagattgacgaggccagtccgctcttcggcatcagccggcaggacctgcagatggacgactttgagatcgtgatcatcctggaaggcattgtggaggccacagccatgaccacccaggcccgcagctcctacctggccaatgagatcctgtggggtcaccgctttgagcccgtgctcttcgagaagaaccagtacaagattgactacttgcacttccacaagacctatgaggtgccctctacaccccgctgcagcgcgaaggatctggtggagaacaagttcctgctgcccagggccaactccttctgctacaagaacgagctggccttcctgagccgtgacgaggaggatgaggcggacggagaccaggatggccgaagccgggaaggcctcatcccccaggccaggcatgactttgacagactccaggctggtggcggggtcctggagcagcggccctacagacgggagtcagagatctaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]