2025-09-19 21:43:29, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS NM_001396083 321 bp mRNA linear PRI 26-JUN-2025 DEFINITION Homo sapiens small cysteine and glycine repeat containing 10 (gene/pseudogene) (SCYGR10), transcript variant 1, mRNA. ACCESSION NM_001396083 VERSION NM_001396083.1 KEYWORDS RefSeq; RefSeq Select. SOURCE Homo sapiens (human) ORGANISM Homo sapiens Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo. REFERENCE 1 (bases 1 to 321) AUTHORS Wu,D.D., Irwin,D.M. and Zhang,Y.P. TITLE Molecular evolution of the keratin associated protein gene family in mammals, role in the evolution of mammalian hair JOURNAL BMC Evol Biol 8, 241 (2008) PUBMED 18721477 REMARK Erratum:[BMC Evol Biol. 2009;9:213] Publication Status: Online-Only COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from CM004594.1. Summary: This gene is a member of a large gene family that encodes keratin associated proteins (KRTAP) that play a role in hair formation. This gene belongs to a subfamily of the KRTAP family termed small cysteine and glycine repeat containing (SCYGR) genes and it resides in a cluster of SCYGR genes on chromosome 2q36.3. Allelic polymorphisms in this gene result in both coding and non-coding transcripts; the reference genome represents the non-coding allele. [provided by RefSeq, Jan 2024]. Transcript Variant: This variant (1) represents a common allele that is predicted to encode a protein of 106 aa. ##RefSeq-Attributes-START## polymorphic pseudogene :: based on alignments, homology RefSeq Select criteria :: based on single protein-coding transcript ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-321 CM004594.1 222175361-222175681 FEATURES Location/Qualifiers source 1..321 /organism="Homo sapiens" /mol_type="mRNA" /db_xref="taxon:9606" /chromosome="2" /map="2q36.3" gene 1..321 /gene="SCYGR10" /gene_synonym="KRTAP28-10; KRTAP28p2" /note="small cysteine and glycine repeat containing 10 (gene/pseudogene)" /db_xref="GeneID:112441436" /db_xref="HGNC:HGNC:34221" CDS 1..321 /gene="SCYGR10" /gene_synonym="KRTAP28-10; KRTAP28p2" /note="keratin associated protein 28-910; keratin associated protein 28 family pseudogene 2" /codon_start=1 /product="small cysteine and glycine repeat-containing protein 10" /protein_id="NP_001383012.1" /db_xref="GeneID:112441436" /db_xref="HGNC:HGNC:34221" /translation="
MGCCGCGGCGGRCSGGCGGGCGGGCGGGCGGGCGGGCGGDCGSCTTCRCYRVGCCSSCCPCCRGCCGGCCSTPVICCCRRTCRSCGCSCGKSCCQQKCCCQKQCCC"
exon 1..321 /gene="SCYGR10" /gene_synonym="KRTAP28-10; KRTAP28p2" /inference="alignment:Splign:2.1.0" ORIGIN
atgggttgctgtggttgtggtggctgcggtggccgctgcagtggtggctgtggtggtggctgtggtggtggctgcggtggtggctgtggtggtggctgtggtggtggctgcggtggtgactgtggcagctgcaccacctgcaggtgctaccgggtgggctgctgctccagctgctgcccctgctgccgcggctgctgtggaggctgctgcagcactcccgtgatctgctgttgccgccgcacctgccgctcatgtggctgcagctgtgggaagagctgttgccagcagaagtgctgctgccagaagcaatgctgctgttag
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]