ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2024-05-04 07:22:00, GGRNA.v2 : RefSeq release 222 (Jan, 2024)
LOCUS NM_001349368 1584 bp mRNA linear PRI 02-AUG-2023
DEFINITION Homo sapiens centromere protein K (CENPK), transcript variant 4,
mRNA.
ACCESSION NM_001349368 XM_017009698
VERSION NM_001349368.2
KEYWORDS RefSeq.
SOURCE Homo sapiens (human)
ORGANISM Homo sapiens
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
REFERENCE 1 (bases 1 to 1584)
AUTHORS Li X, Han YR, Xuefeng X, Ma YX, Xing GS, Yang ZW, Zhang Z, Shi L
and Wu XL.
TITLE Lentivirus-mediated short hairpin RNA interference of CENPK
inhibits growth of colorectal cancer cells with overexpression of
Cullin 4A
JOURNAL World J Gastroenterol 28 (37), 5420-5443 (2022)
PUBMED 36312839
REMARK GeneRIF: Lentivirus-mediated short hairpin RNA interference of
CENPK inhibits growth of colorectal cancer cells with
overexpression of Cullin 4A.
REFERENCE 2 (bases 1 to 1584)
AUTHORS Tian T, Chen L, Dou Z, Yang Z, Gao X, Yuan X, Wang C, Liu R, Shen
Z, Gui P, Teng M, Meng X, Hill DL, Li L, Zhang X, Liu X, Sun L,
Zang J and Yao X.
TITLE Structural insights into human CCAN complex assembled onto DNA
JOURNAL Cell Discov 8 (1), 90 (2022)
PUBMED 36085283
REMARK Publication Status: Online-Only
REFERENCE 3 (bases 1 to 1584)
AUTHORS Tian H, Wang F, Deng Y, Ying L, Fang W, Chen D, Miao C, Li H, Sun
S, Ma Y, Cai H and Guo T.
TITLE Centromeric protein K (CENPK) promotes gastric cancer proliferation
and migration via interacting with XRCC5
JOURNAL Gastric Cancer 25 (5), 879-895 (2022)
PUBMED 35715658
REMARK GeneRIF: Centromeric protein K (CENPK) promotes gastric cancer
proliferation and migration via interacting with XRCC5.
REFERENCE 4 (bases 1 to 1584)
AUTHORS Lin X, Wang F, Chen J, Liu J, Lin YB, Li L, Chen CB and Xu Q.
TITLE N6-methyladenosine modification of CENPK mRNA by ZC3H13 promotes
cervical cancer stemness and chemoresistance
JOURNAL Mil Med Res 9 (1), 19 (2022)
PUBMED 35418160
REMARK GeneRIF: N(6)-methyladenosine modification of CENPK mRNA by ZC3H13
promotes cervical cancer stemness and chemoresistance.
Publication Status: Online-Only
REFERENCE 5 (bases 1 to 1584)
AUTHORS Li Q, Liang J, Zhang S, An N, Xu L and Ye C.
TITLE Overexpression of centromere protein K (CENPK) gene in
Differentiated Thyroid Carcinoma promote cell Proliferation and
Migration
JOURNAL Bioengineered 12 (1), 1299-1310 (2021)
PUBMED 33904381
REMARK GeneRIF: Overexpression of centromere protein K (CENPK) gene in
Differentiated Thyroid Carcinoma promote cell Proliferation and
Migration.
REFERENCE 6 (bases 1 to 1584)
AUTHORS Okada M, Cheeseman IM, Hori T, Okawa K, McLeod IX, Yates JR 3rd,
Desai A and Fukagawa T.
TITLE The CENP-H-I complex is required for the efficient incorporation of
newly synthesized CENP-A into centromeres
JOURNAL Nat Cell Biol 8 (5), 446-457 (2006)
PUBMED 16622420
REFERENCE 7 (bases 1 to 1584)
AUTHORS Foltz DR, Jansen LE, Black BE, Bailey AO, Yates JR 3rd and
Cleveland DW.
TITLE The human CENP-A centromeric nucleosome-associated complex
JOURNAL Nat Cell Biol 8 (5), 458-469 (2006)
PUBMED 16622419
REFERENCE 8 (bases 1 to 1584)
AUTHORS Obuse C, Yang H, Nozaki N, Goto S, Okazaki T and Yoda K.
TITLE Proteomics analysis of the centromere complex from HeLa interphase
cells: UV-damaged DNA binding protein 1 (DDB-1) is a component of
the CEN-complex, while BMI-1 is transiently co-localized with the
centromeric region in interphase
JOURNAL Genes Cells 9 (2), 105-120 (2004)
PUBMED 15009096
REFERENCE 9 (bases 1 to 1584)
AUTHORS Yamashita A, Ito M, Takamatsu N and Shiba T.
TITLE Characterization of Solt, a novel SoxLZ/Sox6 binding protein
expressed in adult mouse testis
JOURNAL FEBS Lett 481 (2), 147-151 (2000)
PUBMED 10996314
REFERENCE 10 (bases 1 to 1584)
AUTHORS Taki T, Hayashi Y, Taniwaki M, Seto M, Ueda R, Hanada R, Suzukawa
K, Yokota J and Morishita K.
TITLE Fusion of the MLL gene with two different genes, AF-6 and
AF-5alpha, by a complex translocation involving chromosomes 5, 6, 8
and 11 in infant leukemia
JOURNAL Oncogene 13 (10), 2121-2130 (1996)
PUBMED 8950979
COMMENT VALIDATED REFSEQ: This record has undergone validation or
preliminary review. The reference sequence was derived from
BG502832.1, BG505115.1, BF211376.1, BC005400.1 and BC008504.1.
On Jun 1, 2019 this sequence version replaced NM_001349368.1.
Summary: CENPK is a subunit of a CENPH (MIM 605607)-CENPI (MIM
300065)-associated centromeric complex that targets CENPA (MIM
117139) to centromeres and is required for proper kinetochore
function and mitotic progression (Okada et al., 2006 [PubMed
16622420]).[supplied by OMIM, Mar 2008].
Transcript Variant: This variant (4) differs in the 5' UTR, lacks a
portion of the 5' coding region, initiates translation at a
downstream start codon, and lacks an alternate in-frame exon in its
central coding region, compared to variant 1. The encoded isoform
(4) has a shorter N-terminus and lacks an internal segment compared
to isoform 1.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: SRR14038197.665842.1,
SRR14243140.10948083.1 [ECO:0000332]
RNAseq introns :: mixed sample support SAMEA1965299,
SAMEA1966682 [ECO:0006172]
##Evidence-Data-END##
COMPLETENESS: complete on the 3' end.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
1-41 BG502832.1 2-42
42-444 BG505115.1 10-412
445-652 BF211376.1 46-253
653-981 BC005400.1 756-1084
982-1584 BC008504.1 1129-1731
FEATURES Location/Qualifiers
source 1..1584
/organism="Homo sapiens"
/mol_type="mRNA"
/db_xref="taxon:9606"
/chromosome="5"
/map="5q12.3"
gene 1..1584
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/note="centromere protein K"
/db_xref="GeneID:64105"
/db_xref="HGNC:HGNC:29479"
/db_xref="MIM:611502"
exon 1..71
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/inference="alignment:Splign:2.1.0"
variation 1
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:1359976795"
variation 2
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1313487734"
variation 3
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/db_xref="dbSNP:1752349587"
variation 6
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1752348893"
variation 7
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1752348579"
variation 8
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1306504051"
variation 9
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/db_xref="dbSNP:1342831242"
variation 11..20
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="ggggctggca"
/replace="ggggctggcaggggctggca"
/db_xref="dbSNP:1485277906"
variation 11
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1752347563"
variation 12
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1231982437"
variation 13
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:1028359789"
variation 14
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:542352928"
variation 15
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1210224911"
variation 19
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1265798087"
variation 21
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1752345149"
variation 22..25
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="gc"
/replace="gcgc"
/db_xref="dbSNP:1257636747"
variation 24
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/db_xref="dbSNP:1226707165"
variation 28
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1752344063"
variation 29
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1752343711"
variation 30
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:748792667"
variation 31
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:1422047918"
variation 32
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1412446096"
variation 33
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1473419782"
variation 34
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:2150581284"
variation 35
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/db_xref="dbSNP:1752342051"
variation 36
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1343690787"
variation 37
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:140804671"
variation 39
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:553552680"
variation 40
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1752340528"
variation 41
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:9791024"
variation 42
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1404435189"
variation 45
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1413477558"
variation 46
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1011178654"
variation 48
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:892736211"
variation 49
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1293152372"
variation 50
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="t"
/db_xref="dbSNP:1752337962"
variation 52
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1004353263"
variation 53
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1364825946"
variation 55
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:1752336831"
variation 56
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:41268429"
variation 61
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/db_xref="dbSNP:1027093258"
variation 62
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1003673595"
variation 63
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:995243929"
variation 64
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:558001621"
variation 69
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1368732818"
variation 71
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:1157875168"
exon 72..173
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/inference="alignment:Splign:2.1.0"
variation 72
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:548499564"
variation 75..77
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="tag"
/replace="tagttag"
/db_xref="dbSNP:1038778849"
variation 77
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:757254302"
variation 84
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1751964644"
variation 85
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1225478568"
variation 86
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/db_xref="dbSNP:1375448951"
variation 90
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/db_xref="dbSNP:1751963569"
variation 93
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1001509723"
variation 94
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1445804221"
variation 99
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1171663462"
variation 101
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:1581126138"
variation 103
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/db_xref="dbSNP:1374448596"
variation 104
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:906122153"
variation 107
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/db_xref="dbSNP:902390139"
variation 114
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1470058908"
variation 115
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/db_xref="dbSNP:1751960081"
variation 119
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1581126047"
misc_feature 126..128
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/note="upstream in-frame stop codon"
variation 127
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:2150571791"
variation 129
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1358207757"
variation 130
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1173365559"
variation 131
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1751958616"
variation 133
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1330586449"
variation 134
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="t"
/db_xref="dbSNP:1337771016"
variation 135
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:1401876701"
variation 137
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/db_xref="dbSNP:1440214129"
variation 140
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1581125889"
variation 145
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/db_xref="dbSNP:1751955831"
variation 146
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1751955343"
variation 148
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1409398045"
variation 155
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:189373120"
variation 165
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1158620897"
variation 168
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1751953447"
variation 170
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1024707099"
variation 171
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:950264084"
variation 172
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1013728629"
variation 173
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1053275890"
exon 174..275
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/inference="alignment:Splign:2.1.0"
variation 175
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:757460492"
variation 177
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:777895549"
variation 181
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:2096371242"
variation 183
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:935938524"
variation 186
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:2150532568"
variation 187
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:758896315"
variation 188
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:75497175"
variation 190
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1216026136"
variation 193
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:371070860"
variation 200
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/db_xref="dbSNP:1750726023"
variation 201
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:760004670"
variation 202
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1750725249"
variation 210
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/db_xref="dbSNP:1397513933"
variation 211
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1750724525"
variation 212
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:754218341"
variation 213
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:766178671"
variation 217
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:760347848"
variation 219
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/db_xref="dbSNP:1348543974"
variation 222..226
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="actga"
/db_xref="dbSNP:1429400174"
variation 224
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:772652364"
variation 225..233
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="gaagaa"
/replace="gaagaagaa"
/db_xref="dbSNP:1347528124"
variation 230
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1423115596"
variation 231
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:1750721303"
variation 234
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:150574725"
variation 236
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:201745679"
variation 238
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1481438294"
variation 239
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:774283954"
variation 240
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:141729484"
variation 243
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1206680426"
variation 247
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1581093357"
variation 253..255
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="aa"
/replace="aaa"
/db_xref="dbSNP:1437145639"
variation 253
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1248409774"
variation 254
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1750716760"
CDS 255..875
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/note="isoform 4 is encoded by transcript variant 4;
leucine zipper protein FKSG14; SoxLZ/Sox6-binding protein
Solt; protein AF-5alpha; interphase centromere complex
protein 37"
/codon_start=1
/product="centromere protein K isoform 4"
/protein_id="NP_001336297.1"
/db_xref="CCDS:CCDS87299.1"
/db_xref="GeneID:64105"
/db_xref="HGNC:HGNC:29479"
/db_xref="MIM:611502"
/translation="
MWKDMEECQNKLSLIGTETLTDSNAQLSLLIMQVKCLTAELSQWQKKTPETIPLTEDVLITLGKEEFQKLRQDLEMVLSTKESKNEKLKEDLERIFNELKTKMLNIKEYKEKLLSTLGEFLEDHFPLPDRSVKKKKKNIQESSVNLITLHEMLEILINRLFDVPHDPYVKISDSFWPPYVELLLRNGIALRHPEDPTRIRLEAFHQ"
misc_feature 255..872
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/note="Centromere-associated protein K; Region: CENP-K;
pfam11802"
/db_xref="CDD:432085"
variation 256
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:749111718"
variation 260
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1750714903"
variation 261
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1263513424"
variation 264
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:775244207"
variation 267
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:771118232"
variation 268
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:747252575"
variation 273
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:868732343"
exon 276..332
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/inference="alignment:Splign:2.1.0"
variation 276
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1750271640"
variation 277
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:543487501"
variation 278
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1043343369"
variation 279
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1750268417"
variation 290
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1448020199"
variation 291
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:762865136"
variation 294
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:775330841"
variation 296
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="t"
/db_xref="dbSNP:148016416"
variation 297
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1750263924"
variation 298..300
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace=""
/replace="ttg"
/db_xref="dbSNP:779227890"
variation 298
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1454849271"
variation 300
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:144481454"
variation 301
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:2150519689"
variation 303
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:745593902"
variation 308..319
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="aacactcaccga"
/db_xref="dbSNP:1242902542"
variation 310..316
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="cac"
/replace="cactcac"
/db_xref="dbSNP:757802386"
variation 310
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:946304876"
variation 312
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/db_xref="dbSNP:138527872"
variation 314
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1339735347"
variation 316
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/db_xref="dbSNP:2150519582"
variation 317
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:757907403"
variation 318
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:141548635"
variation 322
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/db_xref="dbSNP:201709067"
variation 329
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:755596314"
variation 330
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:764377925"
exon 333..405
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/inference="alignment:Splign:2.1.0"
variation 334
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:749320661"
variation 335
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:780631678"
variation 339..343
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="tt"
/replace="ttgtt"
/db_xref="dbSNP:1750067937"
variation 339
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:1750068401"
variation 347
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1750067487"
variation 349
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:532263854"
variation 350
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:1328421596"
variation 351
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/db_xref="dbSNP:1750066060"
variation 353
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/db_xref="dbSNP:1750065565"
variation 354
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1278922834"
variation 359
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:746283375"
variation 362..364
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="ttt"
/replace="tttt"
/db_xref="dbSNP:1388017290"
variation 368
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:781388497"
variation 369
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:751218204"
variation 370
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1406983239"
variation 375
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1391243960"
variation 376..382
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="tca"
/replace="tcagtca"
/db_xref="dbSNP:762598205"
variation 376
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1561685621"
variation 377
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:777349763"
variation 378
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:185445391"
variation 379
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1425260470"
variation 383
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:749780402"
variation 384
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1750057694"
variation 386
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1477188242"
variation 387
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/db_xref="dbSNP:1750056781"
variation 389
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1750056286"
variation 390..396
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="aaaaaaa"
/replace="aaaaaaaa"
/db_xref="dbSNP:750256768"
variation 392
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:377608156"
variation 396
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:549718297"
variation 397
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1750053838"
variation 398
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="t"
/db_xref="dbSNP:759373577"
variation 399
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:753728671"
variation 402
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:1561685364"
variation 405
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1693238677"
exon 406..452
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/inference="alignment:Splign:2.1.0"
variation 408
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1438182467"
variation 411
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:557986609"
variation 413
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/db_xref="dbSNP:764452510"
variation 415
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:763064949"
variation 416
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/db_xref="dbSNP:1483041739"
variation 417
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1748212552"
variation 420
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1748212077"
variation 421..422
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace=""
/replace="aa"
/db_xref="dbSNP:1403653612"
variation 425
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:765236390"
variation 426
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:548653305"
variation 428
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:771385648"
variation 429
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="cc"
/db_xref="dbSNP:1286587676"
variation 431
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:138507676"
variation 435
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1314951065"
variation 436
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:974580309"
variation 439
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:773540586"
variation 441..442
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="gg"
/db_xref="dbSNP:1581021207"
variation 442
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/db_xref="dbSNP:2150453321"
variation 446
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1581021175"
variation 448..449
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace=""
/replace="aa"
/db_xref="dbSNP:779363914"
variation 448..449
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="aa"
/db_xref="dbSNP:1748205064"
variation 449
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1228585329"
exon 453..535
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/inference="alignment:Splign:2.1.0"
variation 455
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/db_xref="dbSNP:1393117032"
variation 458
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1180206825"
variation 464
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:2150375703"
variation 468
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:773628734"
variation 472
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1237140365"
variation 481
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:1232231851"
variation 483
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1193606113"
variation 484
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1745284481"
variation 485
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:547550705"
variation 486
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/db_xref="dbSNP:1745283514"
variation 488
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:1186908669"
variation 492
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="t"
/db_xref="dbSNP:748490924"
variation 493
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:773901255"
variation 496
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="t"
/db_xref="dbSNP:2150375557"
variation 502
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/db_xref="dbSNP:768317556"
variation 503
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/db_xref="dbSNP:1561634678"
variation 505
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="t"
/db_xref="dbSNP:748850005"
variation 508
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1745280061"
variation 509
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:145897680"
variation 510
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:753691260"
variation 515
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1376463567"
variation 516
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1327050486"
variation 518..521
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace=""
/replace="aaag"
/db_xref="dbSNP:2150375437"
variation 523
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:140748564"
variation 525
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1286143770"
variation 526
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="t"
/db_xref="dbSNP:1745276214"
variation 527
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:745797201"
variation 528
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="t"
/db_xref="dbSNP:1302333711"
variation 530
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1434037126"
variation 532
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1580930674"
variation 533
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:909927578"
exon 536..662
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/inference="alignment:Splign:2.1.0"
variation 539
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/db_xref="dbSNP:1745162523"
variation 542
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1192069105"
variation 555
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/db_xref="dbSNP:1745161624"
variation 558..561
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="aaa"
/replace="aaaa"
/db_xref="dbSNP:1238965408"
variation 560
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1745161152"
variation 561
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:752112029"
variation 565
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:1203948509"
variation 567
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:2150372287"
variation 570
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1745159363"
variation 573
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1745158892"
variation 576
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:764451391"
variation 577
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:758865586"
variation 578
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/db_xref="dbSNP:753079695"
variation 582
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:765028924"
variation 584
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:376864120"
variation 593
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/db_xref="dbSNP:1745154105"
variation 596..598
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="gag"
/db_xref="dbSNP:1231746887"
variation 596
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1216777810"
variation 597
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/db_xref="dbSNP:1745152720"
variation 601
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1378696125"
variation 608
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:538146502"
variation 609
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:868259372"
variation 611
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1745150168"
variation 614
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:1745149712"
variation 615
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:765914401"
variation 616
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1185768219"
variation 619
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:569355500"
variation 620
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:377239133"
variation 621
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:773227049"
variation 623
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1745146291"
variation 624
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/db_xref="dbSNP:1745145818"
variation 626
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1172188810"
variation 630
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:866918568"
variation 631
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:771962047"
variation 633
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:774114264"
variation 635
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1176885832"
variation 636
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1468783521"
variation 641
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:770061194"
variation 643
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:151068525"
variation 646
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:781204320"
variation 647
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:759021447"
variation 651..655
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="aaaaa"
/replace="aaaaaa"
/db_xref="dbSNP:1284629517"
variation 653
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1745140405"
variation 657..661
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="aaa"
/replace="aaaa"
/replace="aaaaa"
/db_xref="dbSNP:1745137975"
variation 657
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:757372616"
variation 662
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1409007703"
exon 663..716
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/inference="alignment:Splign:2.1.0"
variation 663
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1213991862"
variation 664..674
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="aa"
/replace="aaaacattcaa"
/db_xref="dbSNP:1743744485"
variation 667
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="t"
/db_xref="dbSNP:774200181"
variation 669
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1270744844"
variation 670
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:1561615890"
variation 672
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1219885542"
variation 676
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1308635150"
variation 682
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:759382373"
variation 693
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/db_xref="dbSNP:776934831"
variation 694
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1580880398"
variation 698
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:376455824"
variation 701
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1743741013"
variation 703
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:747162578"
variation 708
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1743739935"
variation 710
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1440453004"
variation 716
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/db_xref="dbSNP:777984796"
exon 717..1584
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/inference="alignment:Splign:2.1.0"
variation 718
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1193515151"
variation 719
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1457022289"
variation 722
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1407171241"
variation 723..729
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="ata"
/replace="ataaata"
/db_xref="dbSNP:1410263007"
variation 723
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1484537441"
variation 724
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:779591294"
variation 726..729
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="aata"
/db_xref="dbSNP:774484343"
variation 727
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1210752666"
variation 729
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1346222240"
variation 730..733
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace=""
/replace="gatt"
/db_xref="dbSNP:1240110785"
variation 735..737
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="tt"
/replace="ttt"
/db_xref="dbSNP:1161999795"
variation 735
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="t"
/db_xref="dbSNP:1322275300"
variation 739
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1335325956"
variation 741
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:769017086"
variation 746
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:749715663"
variation 747
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:755866468"
variation 748..759
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="atg"
/replace="atgatccatatg"
/db_xref="dbSNP:1329394537"
variation 748..749
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="at"
/replace="ataat"
/db_xref="dbSNP:1373474133"
variation 748
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:542463893"
variation 749
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:145412104"
variation 750..751
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace=""
/replace="tttttt"
/db_xref="dbSNP:771313026"
variation 753
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:960235172"
variation 754
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1454009624"
variation 755
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1362811635"
variation 758
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1580864222"
variation 759
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:1743131833"
variation 762..765
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="aaa"
/replace="aaaa"
/db_xref="dbSNP:1743131212"
variation 767
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:756782808"
variation 769
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:368786771"
variation 771
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:1257572242"
variation 779
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:919152018"
variation 781
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1489193688"
variation 782
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:1034387973"
variation 783..784
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="cc"
/db_xref="dbSNP:749720138"
variation 784
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1484974307"
variation 785
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:112503088"
variation 787
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1001989973"
variation 788
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:899250076"
variation 791
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:762786158"
variation 801
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1016654387"
variation 803
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:141551708"
variation 805
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1206028496"
variation 807
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:752602369"
variation 808
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:147863579"
variation 809
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1004913643"
variation 810
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1207772442"
variation 811
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:759344010"
variation 812
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1161689071"
variation 813
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1743117164"
variation 816
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/db_xref="dbSNP:1386097326"
variation 821
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/db_xref="dbSNP:528929654"
variation 822..823
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="t"
/replace="tt"
/db_xref="dbSNP:1580863575"
variation 825
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/db_xref="dbSNP:1743115124"
variation 827
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="t"
/db_xref="dbSNP:1001577205"
variation 829
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1334649862"
variation 835
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:773588233"
variation 837
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:772376049"
variation 838
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1414102882"
variation 840
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/db_xref="dbSNP:1350727271"
variation 844
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:762026997"
variation 846
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:774554899"
variation 847
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:749758005"
variation 849
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:746284263"
variation 851
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:775999649"
variation 853
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:375568861"
variation 855
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="t"
/db_xref="dbSNP:746181867"
variation 859
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1163495587"
variation 861
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1228791496"
variation 862
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:933805256"
variation 863
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:1279834410"
variation 866
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/db_xref="dbSNP:1487486189"
variation 868
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1244285837"
variation 872
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:36068055"
variation 878
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:756880796"
variation 883..886
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="tttt"
/replace="ttttt"
/db_xref="dbSNP:1743101471"
variation 888
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:1260071196"
variation 889
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:746580111"
variation 890
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1469027129"
variation 891
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="t"
/db_xref="dbSNP:777142009"
variation 893
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:757857332"
variation 894
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace=""
/replace="c"
/db_xref="dbSNP:1472961778"
variation 895
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:748983371"
variation 897
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:942422849"
variation 898
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/db_xref="dbSNP:752587413"
variation 902..906
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="aaaaa"
/replace="aaaaaa"
/db_xref="dbSNP:1410026237"
variation 902
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:765169647"
variation 903
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/db_xref="dbSNP:1743095898"
variation 907
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="t"
/db_xref="dbSNP:1554102945"
variation 908
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:1743094716"
variation 909
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:754847602"
variation 910
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:753650693"
variation 913
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:149505574"
variation 914
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/db_xref="dbSNP:1172922491"
variation 915
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1394689518"
variation 923
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:762116904"
variation 924..927
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="t"
/replace="tatt"
/db_xref="dbSNP:1743090541"
variation 924
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1459452062"
variation 925
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:774559990"
variation 926
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1743091117"
variation 938
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:1649200052"
variation 939
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1743090066"
variation 941
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1329637299"
variation 943
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:904709766"
variation 947
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1743088868"
variation 950
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="t"
/db_xref="dbSNP:1039179836"
variation 951
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/db_xref="dbSNP:2150328447"
variation 952
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/db_xref="dbSNP:1312201262"
variation 955..957
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="aca"
/db_xref="dbSNP:1561607792"
variation 956..958
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace=""
/replace="cat"
/db_xref="dbSNP:1743086947"
variation 961
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:1743086428"
variation 964
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1743085588"
variation 968
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1743084567"
variation 969
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1370569166"
variation 972
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="t"
/db_xref="dbSNP:1743083080"
variation 974
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/db_xref="dbSNP:1743082614"
variation 975
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:978818163"
variation 976
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:577792004"
variation 977
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1349464377"
variation 978
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/db_xref="dbSNP:945753719"
variation 979
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:913482577"
variation 982..988
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace=""
/replace="gccatct"
/db_xref="dbSNP:3050538"
variation 982..988
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="gccatct"
/replace="gccatctgccatct"
/db_xref="dbSNP:2150328214"
variation 982
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:1580862389"
variation 986..989
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="t"
/replace="tctt"
/db_xref="dbSNP:764130293"
variation 987..993
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="ctt"
/replace="cttactt"
/db_xref="dbSNP:750310884"
variation 987
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/db_xref="dbSNP:993073629"
variation 988
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:199686668"
variation 990
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:960287476"
variation 991
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:557852862"
variation 996
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:2150328136"
variation 1001
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1217910725"
variation 1002
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/db_xref="dbSNP:11952932"
variation 1006
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1743074804"
variation 1007
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1207342510"
variation 1009
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1051477604"
variation 1014
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:980313749"
variation 1016
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1379083883"
variation 1018
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/db_xref="dbSNP:1743072067"
variation 1019
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:771152778"
variation 1021
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/db_xref="dbSNP:1476923760"
variation 1023
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:963780201"
variation 1037
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="t"
/db_xref="dbSNP:1172842501"
variation 1039
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:1743069976"
variation 1045
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1743069574"
variation 1047
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="t"
/db_xref="dbSNP:1743069146"
variation 1048
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1743068751"
variation 1056
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1016373653"
variation 1070
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1743067853"
variation 1074
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1743067391"
variation 1075
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1743066970"
variation 1079
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1743066553"
variation 1080
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/db_xref="dbSNP:1743066123"
variation 1082
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:377015673"
variation 1083
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:1743065238"
variation 1084
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1431598611"
variation 1085
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1476832769"
variation 1096
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1743063753"
variation 1097
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1743063346"
variation 1100
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1743062908"
variation 1102
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1743062518"
variation 1116
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1005290916"
variation 1119
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/db_xref="dbSNP:1743061710"
variation 1122
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1743061305"
variation 1126
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1395176719"
variation 1127..1128
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="aa"
/db_xref="dbSNP:1743060475"
variation 1129
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:950730610"
variation 1130
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:918903214"
variation 1134..1138
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="cttac"
/replace="cttacttac"
/db_xref="dbSNP:1743058362"
variation 1136
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="t"
/db_xref="dbSNP:1743059183"
variation 1137
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="t"
/db_xref="dbSNP:1580861850"
variation 1138
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1743057940"
variation 1139
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/db_xref="dbSNP:1030344060"
variation 1142
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:998061561"
variation 1145
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1743056633"
variation 1147
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1743056190"
variation 1150..1154
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="tt"
/replace="ttctt"
/db_xref="dbSNP:1379062344"
variation 1153
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:1743055799"
variation 1160
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1232536793"
variation 1161
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/db_xref="dbSNP:1743054584"
variation 1163
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:901106029"
variation 1170..1172
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="tt"
/replace="ttt"
/db_xref="dbSNP:2150327537"
variation 1177
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1303180714"
variation 1183
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1743053398"
variation 1187
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:963227783"
variation 1205
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1039911851"
variation 1206
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:926467233"
variation 1207
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1743050692"
variation 1209..1210
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="aa"
/db_xref="dbSNP:1743050266"
variation 1211
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/db_xref="dbSNP:1231285212"
variation 1213
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1743049462"
variation 1215
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:138007557"
variation 1217
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/db_xref="dbSNP:1743048540"
variation 1218
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1338827386"
variation 1222
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="aa"
/db_xref="dbSNP:1210597400"
variation 1222
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1743047305"
variation 1224
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/db_xref="dbSNP:1743046847"
variation 1225
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:2150327342"
variation 1227..1230
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="tttt"
/replace="ttttt"
/db_xref="dbSNP:1743045993"
variation 1227
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1269715863"
variation 1231
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1260858610"
variation 1237
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:2150327288"
variation 1241
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1195775126"
variation 1242
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:970156172"
variation 1248
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:2150327248"
variation 1249
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1743044194"
variation 1259
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:555421066"
variation 1266
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1743043231"
variation 1267
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1743042786"
variation 1269
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1743042345"
variation 1271
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1743041595"
variation 1274
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="t"
/db_xref="dbSNP:1248470707"
variation 1277
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:535728857"
variation 1279
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/db_xref="dbSNP:1743040225"
variation 1280
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1743039797"
variation 1283
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1743039346"
variation 1289
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1743038929"
variation 1295
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1743038506"
variation 1300
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="t"
/db_xref="dbSNP:1743038099"
variation 1301..1304
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="aaaa"
/replace="aaaaaa"
/db_xref="dbSNP:1743037214"
variation 1302
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/db_xref="dbSNP:1743037649"
variation 1305..1306
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="tt"
/replace="tttt"
/db_xref="dbSNP:1743036202"
variation 1305
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:181291384"
variation 1308
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/db_xref="dbSNP:956248428"
variation 1309
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1457981299"
variation 1310
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/db_xref="dbSNP:191377833"
variation 1311..1315
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="ta"
/replace="taata"
/db_xref="dbSNP:1743032082"
variation 1311
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:1743033537"
variation 1313
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:539417576"
variation 1317
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1164554935"
variation 1319
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1743030703"
variation 1321
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1042853202"
variation 1324
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1199984915"
variation 1335
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/db_xref="dbSNP:1388092390"
variation 1341
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1743028067"
variation 1345
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1343109599"
variation 1346
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1031647042"
variation 1347
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1437815344"
variation 1348
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1743024787"
variation 1351
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="t"
/db_xref="dbSNP:1743024219"
variation 1353
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:1743023557"
variation 1354
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1294075340"
variation 1360
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:945709709"
variation 1362
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:2150326827"
variation 1363
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1743021901"
variation 1364
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1326412701"
variation 1366
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1743021208"
variation 1369
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1000450375"
variation 1370..1371
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace=""
/replace="tt"
/db_xref="dbSNP:1743019563"
variation 1372
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:374187039"
variation 1379
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace=""
/replace="g"
/db_xref="dbSNP:1743018191"
variation 1385
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1743017506"
variation 1386
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:1354485971"
variation 1387
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1056728221"
variation 1393
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:1743016253"
variation 1394
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:1213331032"
variation 1399
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1268486647"
variation 1410
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="t"
/db_xref="dbSNP:1743014908"
variation 1412..1413
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="gg"
/db_xref="dbSNP:1743014111"
variation 1412
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1743014523"
variation 1413
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/db_xref="dbSNP:1039250611"
variation 1414
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1743013272"
variation 1418
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="t"
/db_xref="dbSNP:1743012845"
variation 1426
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/replace="t"
/db_xref="dbSNP:1186533991"
variation 1430
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1743011987"
variation 1433
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1743011557"
variation 1437..1440
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="tt"
/replace="tttt"
/db_xref="dbSNP:1743010647"
variation 1437
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="t"
/db_xref="dbSNP:1340299966"
variation 1440
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1743010222"
variation 1445
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1424395658"
variation 1446
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:532743192"
variation 1447..1454
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="tatta"
/replace="tattatta"
/db_xref="dbSNP:1743008574"
variation 1448
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1366225240"
variation 1453..1457
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="ta"
/replace="taata"
/db_xref="dbSNP:1159449444"
variation 1454
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/db_xref="dbSNP:1460556343"
variation 1457..1463
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="at"
/replace="atatcat"
/db_xref="dbSNP:1459141015"
variation 1458
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1389766148"
variation 1459
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1743006871"
variation 1462
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="t"
/db_xref="dbSNP:1743006467"
variation 1466
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:927562539"
variation 1467
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/db_xref="dbSNP:2150326376"
variation 1468
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/db_xref="dbSNP:1743005152"
variation 1469
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1743004554"
variation 1472
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="t"
/db_xref="dbSNP:1287552641"
variation 1474
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1361828535"
variation 1476
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:980658237"
variation 1480
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1314885435"
variation 1481
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1743001315"
variation 1485
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1743000469"
variation 1490
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace=""
/replace="g"
/db_xref="dbSNP:1353680059"
variation 1493
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="t"
/db_xref="dbSNP:1327594781"
variation 1494
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1051966282"
variation 1499
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1289235686"
variation 1500..1506
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="atta"
/replace="attatta"
/db_xref="dbSNP:1331567359"
variation 1503
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/replace="t"
/db_xref="dbSNP:1742997647"
variation 1505
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1742996975"
variation 1507
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1742995591"
variation 1510
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/replace="g"
/db_xref="dbSNP:1742994796"
variation 1511
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/db_xref="dbSNP:929048520"
variation 1513
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:369693784"
variation 1531
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1259977140"
variation 1538
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/db_xref="dbSNP:1483507690"
variation 1539
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1202138533"
variation 1540
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1742990821"
variation 1544..1547
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="tg"
/replace="tgtg"
/db_xref="dbSNP:897488737"
variation 1552
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:1176718170"
variation 1558..1566
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="aaat"
/replace="aaataaaat"
/db_xref="dbSNP:1421192369"
regulatory 1559..1564
/regulatory_class="polyA_signal_sequence"
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/note="hexamer: AATAAA"
variation 1560
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="c"
/db_xref="dbSNP:1464857841"
variation 1565..1570
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="att"
/replace="attatt"
/db_xref="dbSNP:1580860318"
variation 1573
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="g"
/replace="t"
/db_xref="dbSNP:1742987371"
variation 1574
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="a"
/replace="g"
/db_xref="dbSNP:1742986932"
variation 1581
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="t"
/db_xref="dbSNP:879097828"
variation 1582
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/replace="c"
/replace="g"
/replace="t"
/db_xref="dbSNP:1182336846"
polyA_site 1584
/gene="CENPK"
/gene_synonym="AF5alpha; CENP-K; FKSG14; P33; Solt"
/note="major polyA site"
ORIGIN
gcagaagtccggggctggcaagcgcttcctgcgcagcgcctaggcgacctggagtttgtgacgctgtgatggtctagaggctggagattcaagatctgggtgccatcattttctggttctgttgatgaccctcttccaggttacatacagcttacatcttgcatcctcaagcggaggatctagatccggatagtactacagatgtgggagatgttacaaatactgaagaagaacttattagagaatgtgaagaaatgtggaaagatatggaagaatgtcagaataaattatcacttattggaactgaaacactcaccgattcaaatgctcagctatcattgttaattatgcaagtaaaatgtttaaccgctgaactcagtcaatggcagaaaaaaacacctgaaacaattcccttgactgaagacgttctcataacattaggaaaagaagagttccaaaagctgagacaagatcttgaaatggtactgtccactaaggagtcaaagaatgaaaagttaaaggaagacttagaaagaatctttaatgaactgaaaactaaaatgcttaatataaaagaatataaggagaaactcttgagtaccttgggcgagtttctagaagaccattttcctctgcctgatagaagtgttaaaaagaaaaagaaaaacattcaagaatcatctgtaaacctgataacactgcatgaaatgttagagattcttataaatagattatttgatgttccacatgatccatatgtcaaaattagtgattccttttggccaccttatgttgagctgctgctgcgtaatggaattgccttgagacatccagaagatccaacccgaataagattagaagctttccatcagtaaaaggatgttttcttttttcacacagtaaaaattcttatcattcaaggatattggaaccacaggactatttggataaaaaacattatttgcaaattaatgcgcataggccatcttacttttattgcaaaatggcatgtgctgccatctattattcatttttaaatggtcatttcttattcagtgagtgctttagtgttttaaactatatggataagaatgcaggtagataatattctaggcataaaacatttaatgtaccttacctcatgcaatattctttggattctttgttgatttatgatattgctaatataatattttcttaaaatatataacaatatcttttatgcattttgagttccagctggtgcttctttatatttagaaattataatgggaaggtcatttaatttacagatggttttaaaattgaggtaatatctgaggtggcataatttaaaaatatttagcaaatttgtttcatatatactgtcttatttctagatttgtttaaaattggaatatgaaaaactaatggataaagctagcataaaattgatattttagtttgtattattaatatatcatgttaccttatatattaatctactcttgattctgctaattattaccaacaaaattgtattcatgacattttattaatcctctgtgaattttctgtaaataaaattatttctgaaaatctcta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]