GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-04-21 01:19:42, GGRNA.v2 : RefSeq release 222 (Jan, 2024)

LOCUS       NM_001173531            1579 bp    mRNA    linear   PRI 25-DEC-2023
DEFINITION  Homo sapiens POU class 5 homeobox 1 (POU5F1), transcript variant 3,
            mRNA.
ACCESSION   NM_001173531
VERSION     NM_001173531.3
KEYWORDS    RefSeq.
SOURCE      Homo sapiens (human)
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 1579)
  AUTHORS   Hong L, Hong S and Zhang X.
  TITLE     Expression and Functional Analysis of core stemness factors OSKM
            (OCT4, SOX2, KLF4, and MYC) in Pan-cancer
  JOURNAL   Medicine (Baltimore) 102 (48), e36433 (2023)
   PUBMED   38050242
  REMARK    GeneRIF: Expression and Functional Analysis of core stemness
            factors OSKM (OCT4, SOX2, KLF4, and MYC) in Pan-cancer.
REFERENCE   2  (bases 1 to 1579)
  AUTHORS   Panayiotou T, Eftychiou M, Patera E, Promponas VJ and Strati K.
  TITLE     A paradigm for post-embryonic Oct4 re-expression: E7-induced
            hydroxymethylation regulates Oct4 expression in cervical cancer
  JOURNAL   J Med Virol 95 (12), e29264 (2023)
   PUBMED   38054553
  REMARK    GeneRIF: A paradigm for post-embryonic Oct4 re-expression:
            E7-induced hydroxymethylation regulates Oct4 expression in cervical
            cancer.
REFERENCE   3  (bases 1 to 1579)
  AUTHORS   Wang X and Dai J.
  TITLE     Concise review: isoforms of OCT4 contribute to the confusing
            diversity in stem cell biology
  JOURNAL   Stem Cells 28 (5), 885-893 (2010)
   PUBMED   20333750
  REMARK    GeneRIF: This review article underscores the importance of
            identifying and discriminating the expression and functions of OCT4
            isoforms in stem cell research.
            Review article
REFERENCE   4  (bases 1 to 1579)
  AUTHORS   Zhang W, Wang X, Xiao Z, Liu W, Chen B and Dai J.
  TITLE     Mapping of the minimal internal ribosome entry site element in the
            human embryonic stem cell gene OCT4B mRNA
  JOURNAL   Biochem Biophys Res Commun 394 (3), 750-754 (2010)
   PUBMED   20230781
  REMARK    GeneRIF: a 30-nt sequence (nt 201-231), which is sufficient to
            promote internal initiation of translation of OCT4B mRNA in
            embryonic stem cells was mapped.
REFERENCE   5  (bases 1 to 1579)
  AUTHORS   Wang X, Zhao Y, Xiao Z, Chen B, Wei Z, Wang B, Zhang J, Han J, Gao
            Y, Li L, Zhao H, Zhao W, Lin H and Dai J.
  TITLE     Alternative translation of OCT4 by an internal ribosome entry site
            and its novel function in stress response
  JOURNAL   Stem Cells 27 (6), 1265-1275 (2009)
   PUBMED   19489092
  REMARK    GeneRIF: OCT4 gene, by the regulation of alternative splicing and
            alternative translation initiation, may carry out more crucial
            roles in many biological events.
            GeneRIF: Shows that isoform OCT4B-190 initiates at a non-AUG (CUG)
            translation initiation codon.
REFERENCE   6  (bases 1 to 1579)
  AUTHORS   Atlasi Y, Mowla SJ, Ziaee SA, Gokhale PJ and Andrews PW.
  TITLE     OCT4 spliced variants are differentially expressed in human
            pluripotent and nonpluripotent cells
  JOURNAL   Stem Cells 26 (12), 3068-3074 (2008)
   PUBMED   18787205
  REMARK    GeneRIF: OCT4 spliced variants are differentially expressed in
            human pluripotent and nonpluripotent cells
REFERENCE   7  (bases 1 to 1579)
  AUTHORS   Lee J, Kim HK, Rho JY, Han YM and Kim J.
  TITLE     The human OCT-4 isoforms differ in their ability to confer
            self-renewal
  JOURNAL   J Biol Chem 281 (44), 33554-33565 (2006)
   PUBMED   16951404
  REMARK    GeneRIF: DNA binding, transactivation, and abilities to confer
            self-renewal of the human OCT-4 isoforms differ
REFERENCE   8  (bases 1 to 1579)
  AUTHORS   Wey E, Lyons GE and Schafer BW.
  TITLE     A human POU domain gene, mPOU, is expressed in developing brain and
            specific adult tissues
  JOURNAL   Eur J Biochem 220 (3), 753-762 (1994)
   PUBMED   7908264
REFERENCE   9  (bases 1 to 1579)
  AUTHORS   Takeda J, Seino S and Bell GI.
  TITLE     Human Oct3 gene family: cDNA sequences, alternative splicing, gene
            organization, chromosomal location, and expression at low levels in
            adult tissues
  JOURNAL   Nucleic Acids Res 20 (17), 4613-4620 (1992)
   PUBMED   1408763
REFERENCE   10 (bases 1 to 1579)
  AUTHORS   Schoorlemmer J and Kruijer W.
  TITLE     Octamer-dependent regulation of the kFGF gene in embryonal
            carcinoma and embryonic stem cells
  JOURNAL   Mech Dev 36 (1-2), 75-86 (1991)
   PUBMED   1723621
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from DQ486514.1, DQ486516.1,
            DQ486515.1 and AI811039.1.
            
            On Aug 13, 2020 this sequence version replaced NM_001173531.2.
            
            Summary: This gene encodes a transcription factor containing a POU
            homeodomain that plays a key role in embryonic development and stem
            cell pluripotency. Aberrant expression of this gene in adult
            tissues is associated with tumorigenesis. This gene can participate
            in a translocation with the Ewing's sarcoma gene on chromosome 21,
            which also leads to tumor formation. Alternative splicing, as well
            as usage of alternative AUG and non-AUG translation initiation
            codons, results in multiple isoforms. One of the AUG start codons
            is polymorphic in human populations. Related pseudogenes have been
            identified on chromosomes 1, 3, 8, 10, and 12. [provided by RefSeq,
            Oct 2013].
            
            Transcript Variant: This variant (3) differs in the 5' UTR, lacks a
            portion of the 5' coding region, and initiates translation at a
            downstream in-frame non-AUG (CUG) start codon, compared to variant
            1. The resulting isoform (2, also known as OCT4B-190) is shorter at
            the N-terminus, compared to isoform 1. Variants 2 and 3 encode the
            same isoform (2). This variant may encode an additional isoform
            through the use of an alternative downstream AUG start codon. Use
            of alternate start codons and the non-AUG start codon is described
            in PMID:19489092.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: KF880691.1, DQ486516.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA2150385, SAMEA2157511
                                           [ECO:0000348]
            ##Evidence-Data-END##
            
            ##RefSeq-Attributes-START##
            non-AUG initiation codon :: PMID: 19489092
            ##RefSeq-Attributes-END##
            COMPLETENESS: complete on the 3' end.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-332               DQ486514.1         1-332
            333-563             DQ486516.1         1-231
            564-564             DQ486515.1         232-232
            565-1565            DQ486516.1         233-1233
            1566-1579           AI811039.1         11-24               c
FEATURES             Location/Qualifiers
     source          1..1579
                     /organism="Homo sapiens"
                     /mol_type="mRNA"
                     /db_xref="taxon:9606"
                     /chromosome="6"
                     /map="6p21.33"
     gene            1..1579
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /note="POU class 5 homeobox 1"
                     /db_xref="GeneID:5460"
                     /db_xref="HGNC:HGNC:9221"
                     /db_xref="MIM:164177"
     exon            1..637
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /inference="alignment:Splign:2.1.0"
     variation       1
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:756575303"
     variation       3..8
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="aaaaa"
                     /replace="aaaaaa"
                     /db_xref="dbSNP:1777333579"
     variation       3
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777333859"
     variation       5
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2151108087"
     variation       15
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:556183524"
     variation       19
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777333028"
     variation       20..21
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:1777332518"
     variation       20
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1230878174"
     variation       22
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1343020362"
     variation       25
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:945378480"
     variation       33
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:915242328"
     variation       35
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1473749165"
     variation       38
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:767061672"
     variation       39
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1244144141"
     variation       41
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1777330580"
     variation       42
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:932840583"
     variation       48
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777330048"
     variation       55
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777329779"
     variation       56
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1323733874"
     variation       59..88
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="caaatagcacttctgtcatgctggatgtca"
                     /replace="caaatagcacttctgtcatgctggatgtcaaatagcacttctgtcatg
                     ctggatgtca"
                     /db_xref="dbSNP:1777326521"
     variation       59
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777329221"
     variation       60
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:3130931"
     variation       61
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2151107929"
     variation       67
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1223033686"
     variation       68
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1054562013"
     variation       70
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1371054306"
     variation       73
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777328204"
     variation       73
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="ggatgaagaacaag"
                     /db_xref="dbSNP:1309830792"
     variation       74..75
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace=""
                     /replace="atgaagaacaagtgccga"
                     /replace="gccga"
                     /db_xref="dbSNP:1409890798"
     variation       74
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1777327959"
     variation       76
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:935889637"
     variation       77
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1308827226"
     variation       79
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777326787"
     variation       90
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1777326233"
     variation       91
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:750002991"
     variation       94
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1777325711"
     variation       95
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777325278"
     variation       101
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:979949563"
     variation       102
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1364491233"
     variation       103
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777324518"
     variation       106
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:573550776"
     variation       107
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:2151107769"
     variation       114
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1300756432"
     variation       115
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:76465289"
     variation       120
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777323508"
     variation       125
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1356944417"
     variation       126
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1777322994"
     variation       127
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777322739"
     variation       130
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777322487"
     variation       132
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1229902923"
     variation       135
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:536581051"
     variation       136
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:983180480"
     variation       137
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1454069209"
     variation       139..141
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="aa"
                     /replace="aaa"
                     /db_xref="dbSNP:1777320959"
     variation       142
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1484264122"
     variation       144
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777320435"
     variation       147
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777320187"
     variation       151
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:769146675"
     variation       154
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:977786363"
     variation       156
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1371506489"
     variation       162
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:566021008"
     variation       163
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777318676"
     variation       167
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1582037748"
     variation       171
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1410508850"
     variation       172
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777317928"
     variation       176
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1173026294"
     variation       179
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:749630858"
     variation       189
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1777317122"
     variation       190
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:2151107559"
     variation       191
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1166012936"
     variation       192
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:950476755"
     variation       193
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777316548"
     variation       199
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2151107531"
     variation       201
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1184040360"
     variation       203
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777316008"
     variation       206
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:776087600"
     variation       221
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200340326"
     variation       222..225
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="atga"
                     /replace="atgatga"
                     /db_xref="dbSNP:67207605"
     variation       222
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1185683743"
     variation       223..224
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace=""
                     /replace="aag"
                     /replace="tag"
                     /db_xref="dbSNP:1777314586"
     variation       223
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:77085553"
     variation       224..226
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="gag"
                     /replace="gaggag"
                     /db_xref="dbSNP:9281235"
     variation       224..225
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="ga"
                     /replace="gaaga"
                     /replace="gacga"
                     /db_xref="dbSNP:1777313779"
     variation       224
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="ggag"
                     /replace="gtgg"
                     /db_xref="dbSNP:72545985"
     variation       225..228
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="agta"
                     /replace="agtagta"
                     /db_xref="dbSNP:2151107394"
     variation       225..226
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="ag"
                     /replace="agaag"
                     /db_xref="dbSNP:141270342"
     variation       226..227
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace=""
                     /replace="gat"
                     /db_xref="dbSNP:1777312621"
     variation       226
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="gagg"
                     /db_xref="dbSNP:1554135573"
     variation       227
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace=""
                     /replace="t"
                     /db_xref="dbSNP:1372634738"
     variation       227
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:201576321"
     variation       227
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="t"
                     /replace="tt"
                     /db_xref="dbSNP:1777312105"
     variation       228..229
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace=""
                     /replace="gt"
                     /db_xref="dbSNP:1561858807"
     variation       228
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1432689419"
     variation       229
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:553951373"
     variation       231
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1340775926"
     variation       233
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777310661"
     variation       234
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1483419984"
     variation       237
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1777310112"
     variation       240
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1450163111"
     variation       248
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1268187140"
     variation       249
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1208146203"
     variation       250
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:917183324"
     variation       256
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777308694"
     variation       258
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1777308361"
     variation       260
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:991404678"
     variation       264
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1238039827"
     variation       271
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:958551486"
     variation       274
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1314969939"
     variation       278
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1443317976"
     variation       279
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1290134588"
     variation       280..284
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="tgt"
                     /replace="tgtgt"
                     /db_xref="dbSNP:571828146"
     variation       280
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1240827545"
     variation       281
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:920402080"
     variation       283
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2151107235"
     variation       286
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:2151107222"
     variation       287
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:995080389"
     variation       289
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777304963"
     variation       294
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:961733064"
     variation       295
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1014676128"
     variation       297
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2151107175"
     variation       299
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777304114"
     variation       300..301
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="cc"
                     /replace="ccc"
                     /db_xref="dbSNP:1777303834"
     variation       302
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2151107154"
     variation       308
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1172171053"
     variation       313
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777303249"
     variation       314
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1402669669"
     variation       319
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1777302766"
     variation       320
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1280756512"
     variation       321
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1388044631"
     variation       323
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:72856737"
     variation       328
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:868073649"
     variation       329
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2151107091"
     variation       331
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:571668450"
     variation       333
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:759635638"
     variation       338
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2151107071"
     variation       340
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1368067216"
     variation       346
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1232121017"
     variation       348
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:545437201"
     variation       349
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:9263800"
     variation       355
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1777299299"
     variation       356
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777299064"
     variation       357
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:11965454"
     variation       358
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777298772"
     variation       364
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2151107008"
     variation       365
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2151106995"
     variation       366
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1282835556"
     variation       367..369
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="aca"
                     /db_xref="dbSNP:1429225310"
     variation       367
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1464849350"
     variation       369
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1473170859"
     variation       370
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777297246"
     variation       371
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:893827576"
     variation       374
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1250012422"
     variation       375
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1467154259"
     variation       376
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777296078"
     variation       377
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777295791"
     variation       380..381
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="cc"
                     /db_xref="dbSNP:1198482935"
     variation       380
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1777295522"
     variation       382..386
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="tttt"
                     /replace="ttttt"
                     /db_xref="dbSNP:1378392227"
     variation       384
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1777294937"
     variation       387
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777294345"
     variation       388
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777294068"
     variation       394
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1478925844"
     variation       396
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777293504"
     variation       397
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1156581301"
     variation       400
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1410882052"
     variation       404
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:2151106839"
     variation       407
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:567697919"
     variation       409
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1322418862"
     variation       416
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:3757349"
     variation       434
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:903306193"
     variation       440
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1777291168"
     variation       443
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1777290863"
     variation       448
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2151106776"
     variation       450
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:775390135"
     variation       451
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1323876773"
     variation       453
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1777289999"
     variation       455
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:905789598"
     variation       458..460
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="gag"
                     /db_xref="dbSNP:1777289394"
     variation       460..462
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="gtg"
                     /replace="gtgtg"
                     /db_xref="dbSNP:1777289142"
     variation       466
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:73401031"
     variation       468
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777288544"
     variation       477
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2151106706"
     variation       483
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:2151106697"
     variation       488
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2151106686"
     variation       489
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1777288254"
     variation       494..499
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="tt"
                     /replace="ttcttt"
                     /db_xref="dbSNP:550996676"
     variation       495..497
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="t"
                     /replace="tct"
                     /db_xref="dbSNP:1554135441"
     variation       496
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1554135451"
     variation       496
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1777287697"
     variation       497..508
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="ttttttttt"
                     /replace="tttttttttt"
                     /replace="ttttttttttt"
                     /replace="tttttttttttt"
                     /replace="ttttttttttttt"
                     /db_xref="dbSNP:rs9279005"
     variation       497
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1204843522"
     variation       502
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:949924521"
     variation       504
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1463720016"
     variation       507
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1269728421"
     variation       508
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:201876558"
     variation       509
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1777284056"
     variation       509
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:200941459"
     variation       513
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace=""
                     /replace="g"
                     /db_xref="dbSNP:1322683938"
     variation       513
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1209148552"
     variation       518..521
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="ag"
                     /replace="agag"
                     /db_xref="dbSNP:776463063"
     variation       518
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:1777282729"
     variation       521
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1254214943"
     variation       526
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1250844879"
     variation       527..530
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="ct"
                     /replace="ctct"
                     /db_xref="dbSNP:1234752211"
     variation       529
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777281473"
     variation       531
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1161350339"
     variation       534
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1777280491"
     variation       535
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777280177"
     variation       538
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:950118066"
     variation       540
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1457019029"
     variation       546
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:574609806"
     variation       547
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1582036271"
     variation       555
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1380101000"
     variation       556
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:983642581"
     variation       570
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1306970706"
     variation       575
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1582036200"
     variation       576
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777277431"
     variation       580
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1322911050"
     variation       581
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:929059992"
     variation       585
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777276499"
     variation       586
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1777276066"
     variation       587
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141017974"
     variation       588
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1300309753"
     variation       592
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1777274980"
     variation       595
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1777274684"
     variation       599
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1561857968"
     variation       604
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1582036092"
     variation       605
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777273790"
     variation       608
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:973063617"
     variation       609
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1582036067"
     variation       610
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:964318755"
     variation       611
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777272508"
     misc_feature    623..625
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /note="upstream in-frame stop codon"
     variation       625
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:151095308"
     variation       626
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1777271795"
     variation       628
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1582036011"
     variation       635
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777271173"
     exon            638..758
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /inference="alignment:Splign:2.1.0"
     variation       639
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:768359010"
     variation       642
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1489249310"
     variation       643
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1387884870"
     variation       646
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1167606498"
     variation       649
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:749071230"
     variation       650
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1408966195"
     variation       651
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1288972831"
     variation       653
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1244494688"
     variation       654
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:149025884"
     variation       656
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1226467340"
     variation       657
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:137936040"
     variation       662
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777208385"
     variation       670
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:751745427"
     variation       671
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:777993058"
     variation       673
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1321757885"
     variation       676
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:150320288"
     variation       679
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1274145021"
     variation       680
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2151104326"
     variation       688
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1561856346"
     variation       694
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777205659"
     variation       699
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1777205330"
     variation       706
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1247046824"
     variation       709
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1361655165"
     variation       710
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1272018324"
     variation       718
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777203896"
     variation       724
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1313084641"
     variation       727
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1395953191"
     variation       728
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1374605227"
     variation       736
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:752871883"
     variation       739
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1440419653"
     variation       741
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:910240285"
     CDS             743..1315
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /note="isoform 2 is encoded by transcript variant 3;
                     non-AUG (CUG) translation initiation codon; POU-type
                     homeodomain-containing DNA-binding protein; POU domain
                     transcription factor OCT4; POU domain, class 5,
                     transcription factor 1; octamer-binding protein 3;
                     octamer-binding protein 4; octamer-binding transcription
                     factor 3"
                     /codon_start=1
                     /product="POU domain, class 5, transcription factor 1
                     isoform 2"
                     /protein_id="NP_001167002.1"
                     /db_xref="CCDS:CCDS47398.2"
                     /db_xref="GeneID:5460"
                     /db_xref="HGNC:HGNC:9221"
                     /db_xref="MIM:164177"
                     /translation="
MGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN"
     misc_feature    <743..868
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /note="Pou domain - N-terminal to homeobox domain; Region:
                     Pou; cl22952"
                     /db_xref="CDD:451464"
     misc_feature    821..823
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /note="OCT4B-164; Region: Alternative start codon"
     misc_feature    order(923..937,941..943,992..994,1010..1012,1049..1051,
                     1055..1060,1067..1072,1076..1084,1088..1093)
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238039"
     misc_feature    929..1090
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /note="Homeobox domain; Region: Homeobox; pfam00046"
                     /db_xref="CDD:425441"
     misc_feature    order(929..931,938..940,1058..1060,1067..1072,1079..1081)
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /note="specific DNA base contacts [nucleotide binding];
                     other site"
                     /db_xref="CDD:238039"
     variation       750
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1307000564"
     variation       754
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1582032778"
     variation       755
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1777200309"
     exon            759..889
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /inference="alignment:Splign:2.1.0"
     variation       760
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:754269967"
     variation       764
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1329745808"
     variation       766
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:951425605"
     variation       771
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1298706028"
     variation       778
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:373808092"
     variation       781
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1777172331"
     variation       784
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1362025857"
     variation       787
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1290187689"
     variation       789
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777171228"
     variation       805
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1455194086"
     variation       809
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777170549"
     variation       814
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1387743881"
     variation       816
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:756413624"
     variation       829
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777169354"
     variation       832
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:115234511"
     variation       833
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:768029325"
     variation       834
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1037478772"
     variation       838
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1429404142"
     variation       846
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:2151103219"
     variation       859
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1341968669"
     variation       864
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777167062"
     variation       869
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1007322893"
     variation       874
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1777166338"
     variation       878
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:572480837"
     variation       879
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1777165573"
     variation       885
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1186685294"
     variation       887
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:773889469"
     variation       889
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:763710527"
     exon            890..1048
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /inference="alignment:Splign:2.1.0"
     variation       891
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777140852"
     variation       892
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1777140477"
     variation       893
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1441261772"
     variation       894
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1256075529"
     variation       897
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1196692240"
     variation       901
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1016182724"
     variation       908
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1150767"
     variation       910
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:780201728"
     variation       911
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:750755680"
     variation       916
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:767958442"
     variation       917
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1340827343"
     variation       920
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1315221039"
     variation       921
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1246353090"
     variation       924
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777135286"
     variation       925
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1338565059"
     variation       930
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1333452170"
     variation       932
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777134129"
     variation       937
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1391716274"
     variation       938
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777133457"
     variation       940
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2151102295"
     variation       943
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:757769384"
     variation       948
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1306384765"
     variation       950
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1429420206"
     variation       951
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:751096375"
     variation       952
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:368434272"
     variation       954
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1471859282"
     variation       955
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1368353231"
     variation       957
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777130443"
     variation       958
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1183206781"
     variation       959
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1052108705"
     variation       961
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:578180451"
     variation       976
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:775301501"
     variation       980
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1325738578"
     variation       991
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:764939136"
     variation       997
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:17851818"
     variation       1000
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:951452940"
     variation       1001
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777126425"
     variation       1003
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:776478147"
     variation       1011
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1353681075"
     variation       1014
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:770844532"
     variation       1019
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777125291"
     variation       1021
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:746974556"
     variation       1030
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1352084514"
     variation       1034
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1286303728"
     variation       1035
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1408995142"
     variation       1036
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1427351164"
     variation       1039
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:772966815"
     variation       1040
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:768746587"
     variation       1043
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:749326531"
     variation       1044
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777122104"
     variation       1046
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1390168415"
     exon            1049..1579
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /inference="alignment:Splign:2.1.0"
     variation       1049
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1188579160"
     variation       1050
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:770067555"
     variation       1051
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1246075526"
     variation       1054
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1777088374"
     variation       1055
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1208076129"
     variation       1056
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:746104715"
     variation       1057
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1384083039"
     variation       1059
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1280550252"
     variation       1060
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1298955101"
     variation       1062
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:867664390"
     variation       1066
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:781212227"
     variation       1074
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1271010739"
     variation       1075
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1437313632"
     variation       1076
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1777084166"
     variation       1078
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777083772"
     variation       1085
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777083413"
     variation       1086
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1363163301"
     variation       1091
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777082620"
     variation       1100
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:771345851"
     variation       1102
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:141766253"
     variation       1103
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:778460021"
     variation       1107
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777081085"
     variation       1108
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1174320263"
     variation       1110
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:546320542"
     variation       1111..1115
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="ac"
                     /replace="acaac"
                     /db_xref="dbSNP:765569430"
     variation       1113
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777079901"
     variation       1114
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1423969939"
     variation       1116
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:950764201"
     variation       1118
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1486650077"
     variation       1127
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:758948344"
     variation       1138
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777077666"
     variation       1140
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:752325450"
     variation       1142
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1189046873"
     variation       1151
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:778574549"
     variation       1153
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1314271734"
     variation       1155
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1030266660"
     variation       1160
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1483497814"
     variation       1164
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:974056564"
     variation       1165
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1480295008"
     variation       1168
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777074060"
     variation       1172
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1200837847"
     variation       1173
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:16897482"
     variation       1175
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777072975"
     variation       1176
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1207698528"
     variation       1177
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1432082123"
     variation       1178
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1441659931"
     variation       1183
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:754481951"
     variation       1187
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1230947193"
     variation       1192
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1777070734"
     variation       1198
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:753553081"
     variation       1205
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:765910375"
     variation       1211
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777069475"
     variation       1213
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1246815764"
     variation       1216
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1158543431"
     variation       1219
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1374581600"
     variation       1225
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:997814201"
     variation       1228
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1301635040"
     variation       1231
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777067093"
     variation       1233
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:760558360"
     variation       1236
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1355522268"
     variation       1239
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:750163518"
     variation       1240
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:767500519"
     variation       1241
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1387940273"
     variation       1244
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1016136973"
     variation       1251
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1038848905"
     variation       1252
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:761734933"
     variation       1256
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:986006262"
     variation       1258
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777063161"
     variation       1262
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1348560317"
     variation       1264
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:953270489"
     variation       1265
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1284370986"
     variation       1266
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1318153696"
     variation       1270
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:774206292"
     variation       1271..1273
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace=""
                     /replace="cct"
                     /db_xref="dbSNP:1777060496"
     variation       1271
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:769875118"
     variation       1274
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777060142"
     variation       1279
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1061118"
     variation       1280
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1207558407"
     variation       1284
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1061120"
     variation       1287
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:776940833"
     variation       1290
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1274211726"
     variation       1292
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1222340156"
     variation       1293
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1777056973"
     variation       1294
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:771024256"
     variation       1296
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1223697753"
     variation       1302
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:747446765"
     variation       1310
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1191115401"
     variation       1316
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1427929496"
     variation       1317
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:997296748"
     variation       1320
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:892230384"
     variation       1325
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1554134152"
     variation       1326
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:564148752"
     variation       1332
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1434585421"
     variation       1334..1335
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="aa"
                     /replace="aaa"
                     /db_xref="dbSNP:1408399482"
     variation       1335
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777052599"
     variation       1337..1341
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="gggg"
                     /replace="ggggg"
                     /db_xref="dbSNP:1351162048"
     variation       1337
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1368265136"
     variation       1339
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1307060444"
     variation       1341
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1457938687"
     variation       1343
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1162581262"
     variation       1344..1345
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace=""
                     /replace="ag"
                     /db_xref="dbSNP:1491028222"
     variation       1344
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace=""
                     /replace="a"
                     /db_xref="dbSNP:1163021077"
     variation       1344
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="aa"
                     /db_xref="dbSNP:1554134128"
     variation       1344
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:772503540"
     variation       1346
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:748680648"
     variation       1352
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777048797"
     variation       1354
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1777048444"
     variation       1355
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:903483977"
     variation       1356
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:779517517"
     variation       1359
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:754549702"
     variation       1363
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1251306973"
     variation       1369
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777046704"
     variation       1371
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1061126"
     variation       1376
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777045960"
     variation       1381..1383
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="tt"
                     /replace="ttt"
                     /db_xref="dbSNP:1777045583"
     variation       1384
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777045236"
     variation       1386
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1777044891"
     variation       1387
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1304742773"
     variation       1388
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:2151100101"
     variation       1390
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:3734864"
     variation       1391
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1409164251"
     variation       1392
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1189358100"
     variation       1393
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1777042927"
     variation       1418
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1472556225"
     variation       1420
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1249631450"
     variation       1430
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1226100360"
     variation       1434
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1777041453"
     variation       1440..1442
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="aaa"
                     /replace="aaaaa"
                     /db_xref="dbSNP:60004964"
     variation       1440
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1777041138"
     variation       1441
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:200275741"
     variation       1445
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:917547918"
     variation       1449
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:896681857"
     variation       1460..1462
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="tt"
                     /replace="ttt"
                     /db_xref="dbSNP:746543478"
     variation       1463..1466
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="gggg"
                     /replace="ggggg"
                     /db_xref="dbSNP:1777038521"
     variation       1464
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:938900222"
     variation       1466
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1482261391"
     variation       1467
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1057051690"
     variation       1469
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777037472"
     variation       1474
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1233955454"
     variation       1485
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1777036766"
     variation       1496
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777036406"
     variation       1507
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:930130200"
     variation       1517
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:537327593"
     variation       1518
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1481698220"
     variation       1519
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1265122857"
     variation       1520
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1777034633"
     variation       1523
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:927467930"
     variation       1526
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:980276667"
     variation       1527
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:2151099846"
     variation       1531
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace=""
                     /replace="c"
                     /db_xref="dbSNP:1777033427"
     variation       1532
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1388129250"
     variation       1534
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:1777032759"
     variation       1540..1547
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="taaa"
                     /replace="taaataaa"
                     /db_xref="dbSNP:1409128704"
     variation       1541..1543
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="aa"
                     /replace="aaa"
                     /db_xref="dbSNP:1777032031"
     variation       1541
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1323343063"
     regulatory      1542..1547
                     /regulatory_class="polyA_signal_sequence"
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /note="hexamer: AATAAA"
     variation       1545..1550
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="aa"
                     /replace="aaagaa"
                     /db_xref="dbSNP:1777031252"
     variation       1551..1553
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace=""
                     /replace="gcc"
                     /db_xref="dbSNP:750617181"
     variation       1552
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="g"
                     /db_xref="dbSNP:1313339858"
     variation       1553
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:13409"
     variation       1562
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /db_xref="dbSNP:1356217144"
     variation       1564
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="t"
                     /db_xref="dbSNP:1777029217"
     variation       1568
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:1777028855"
     variation       1569..1571
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="aga"
                     /db_xref="dbSNP:1777028490"
     variation       1572
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="c"
                     /replace="t"
                     /db_xref="dbSNP:983923886"
     variation       1575
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="a"
                     /replace="g"
                     /db_xref="dbSNP:1445660115"
     variation       1578
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /replace="c"
                     /replace="g"
                     /replace="t"
                     /db_xref="dbSNP:974089105"
     polyA_site      1579
                     /gene="POU5F1"
                     /gene_synonym="Oct-3; Oct-4; OCT3; Oct3/4; OCT4; OTF-3;
                     OTF3; OTF4"
                     /note="major polyA site"
ORIGIN      
ggaaaaaaggaaagtgcacttggaagagatccaagtgggcaacttgaagaacaagtgccaaatagcacttctgtcatgctggatgtcagggctctttgtccactttgtatagccgctggcttatagaaggtgctcgataaatctcttgaatttaaaaatcaattaggatgcctctatagtgaaaaagatacagtaaagatgagggataatcaatttaaaaaatgagtaagtacacacaaagcactttatccattcttatgacacctgttacttttttgctgtgtttgtgtgtatgcatgccatgttatagtttgtgggaccctcaaagcaagctggggagagtatatactgaatttagcttctgagacatgatgctcttcctttttaattaacccagaacttagcagcttatctatttctctaatctcaaaacatccttaaactgggggtgatacttgagtgagagaattttgcaggtattaaatgaactatcttcttttttttttttctttgagacagagtcttgctctgtcacccaggctggagtgcagtggcgtgatctcagctcactgcaacctccgcctcccgggttcaagtgattctcctgcctcagcctcctgagtagctgggattacagtcccaggacatcaaagctctgcagaaagaactcgagcaatttgccaagctcctgaagcagaagaggatcaccctgggatatacacaggccgatgtggggctcaccctgggggttctatttgggaaggtattcagccaaacgaccatctgccgctttgaggctctgcagcttagcttcaagaacatgtgtaagctgcggcccttgctgcagaagtgggtggaggaagctgacaacaatgaaaatcttcaggagatatgcaaagcagaaaccctcgtgcaggcccgaaagagaaagcgaaccagtatcgagaaccgagtgagaggcaacctggagaatttgttcctgcagtgcccgaaacccacactgcagcagatcagccacatcgcccagcagcttgggctcgagaaggatgtggtccgagtgtggttctgtaaccggcgccagaagggcaagcgatcaagcagcgactatgcacaacgagaggattttgaggctgctgggtctcctttctcagggggaccagtgtcctttcctctggccccagggccccattttggtaccccaggctatgggagccctcacttcactgcactgtactcctcggtccctttccctgagggggaagcctttccccctgtctccgtcaccactctgggctctcccatgcattcaaactgaggtgcctgcccttctaggaatgggggacagggggaggggaggagctagggaaagaaaacctggagtttgtgccagggtttttgggattaagttcttcattcactaaggaaggaattgggaacacaaagggtgggggcaggggagtttggggcaactggttggagggaaggtgaagttcaatgatgctcttgattttaatcccacatcatgtatcacttttttcttaaataaagaagcctgggacacagtagatagacacactta
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]