GGRNA ver.2 Help | Advanced search | English    旧バージョン

2020-01-28 21:51:12, GGRNA : RefSeq release 97 (Nov, 2019)

Summary:

Results:

検索語に色がつきます重なると色が濃く表示されます。

Homo sapiens ladybird homeobox 1 (LBX1), mRNA. (1287 bp)
misc_feature order(521..535,539..541,590..592,608..610,647..649, 653..658,665..670,674..682,686..691) /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 527..688 /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(527..529,536..538,656..658,665..670,677..679) /gene="LBX1" /gene_synonym="homeobox; HPX-6; HPX6; LBX1H" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039"...
Synonym: homeobox; HPX-6; HPX6; LBX1H
NM_006562.4 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Zea mays Zmhox1a homeobox protein (LOC542406), mRNA. (2873 bp)
LOCUS NM_001111977 2873 bp mRNA linear PLN 04-AUG-2019 DEFINITION Zea mays Zmhox1a homeobox protein (LOC542406), mRNA. ACCESSION NM_001111977 VERSION NM_001111977.1 KEYWORDS RefSeq. SOURCE Zea mays ORGANISM Zea mays Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; Liliopsida; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea. REFERENCE COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from X67561.1. ##Evidence-Data-START## Transcript...
Synonym: GRMZM2G136369; homeobox1; hox1a; Zmhox1a
NM_001111977.1 - Zea mays - NCBI
Strongylocentrotus purpuratus homeobox (H-6 family) (HMX), mRNA. (1402 bp)
misc_feature order(881..895,899..901,950..952,968..970,1007..1009, 1013..1018,1025..1030,1034..1042,1046..1051) /gene="HMX" /gene_synonym="homeobox; SpHmx" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 887..1048 /gene="HMX" /gene_synonym="homeobox; SpHmx" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(887..889,896..898,1016..1018,1025..1030,1037..1039) /gene="HMX" /gene_synonym="homeobox; SpHmx" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" ORIGIN // REFERENCE 1...
Synonym: homeobox; SpHmx
NM_214561.2 - Strongylocentrotus purpuratus (purple sea urchin) - NCBI
Arabidopsis thaliana homeobox-3 (HB-3), mRNA. (1620 bp)
RELATED HOMEOBOX 9" /inference="Similar to RNA sequence, EST:INSD:EG423239.1,INSD:AV537767.1,INSD:EG423238.1, INSD:AU239368.1,INSD:AV530532.1,INSD:AV549782.1, INSD:EG423251.1,INSD:EG423246.1,INSD:EG423245.1, INSD:BP824090.1,INSD:EG423244.1,INSD:AU230666.1, INSD:EG423253.1,INSD:EG423247.1,INSD:DR749859.1, INSD:EG419637.1,INSD:EG423248.1,INSD:EL325055.1, INSD:EH825006.1,INSD:EG423240.1,INSD:EG423243.1, INSD:EG423242.1,INSD:EG419636.1,INSD:DR749858.1" /inference="similar to RNA sequence, mRNA:INSD:AY251401.1,INSD:AK118501.1" /note="homeobox-3 (HB-3); CONTAINS InterPro DOMAIN/s: Homeobox...
Synonym: homeobox-3; STIMPY; STIP; T1B8.31; T1B8_31; WOX9; WOX9A; WUSCHEL related homeobox 9A; WUSCHEL-RELATED HOMEOBOX 9
NM_128948.4 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox-3 (HB-3), mRNA. (1963 bp)
sequence (NC_003071). FEATURES Location/Qualifiers source 1..1963 /organism="Arabidopsis thaliana" /mol_type="mRNA" /db_xref="taxon:3702" /chromosome="2" /ecotype="Columbia" gene 1..1963 /gene="HB-3" /locus_tag="AT2G33880" /gene_synonym="homeobox-3; STIMPY; STIP; T1B8.31; T1B8_31; WOX9; WOX9A; WUSCHEL related homeobox 9A; WUSCHEL-RELATED HOMEOBOX 9" /note="Encodes a protein with similarity to WUS type homeodomain protein. Required for meristem growth and development and acts through positive regulation of WUS. Loss of function phenotypes include embryo lethality, hyponastic cotyledons, reduced...
Synonym: homeobox-3; STIMPY; STIP; T1B8.31; T1B8_31; WOX9; WOX9A; WUSCHEL related homeobox 9A; WUSCHEL-RELATED HOMEOBOX 9
NM_001336476.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Rattus norvegicus homeobox B5 and homeobox B6, opposite strand (Hoxb5os), long non-coding RNA. (594 bp)
LOCUS NR_132637 594 bp RNA linear ROD 08-OCT-2016 DEFINITION Rattus norvegicus homeobox B5 and homeobox B6, opposite strand (Hoxb5os), long non-coding RNA. ACCESSION NR_132637 VERSION NR_132637.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Rattus. COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from AABR07030395.1. Sequence...
NR_132637.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Danio rerio ladybird homeobox 2 (lbx2), mRNA. (1764 bp)
misc_feature order(688..702,706..708,757..759,775..777,814..816, 820..825,832..837,841..849,853..858) /gene="lbx2" /gene_synonym="fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 694..855 /gene="lbx2" /gene_synonym="fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(694..696,703..705,823..825,832..837,844..846) /gene="lbx2" /gene_synonym="fc26c12; homeobox; lbx; lbx1;...
Synonym: fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170
NM_001007134.1 - Danio rerio (zebrafish) - NCBI - UCSC
Danio rerio muscle segment homeobox 3 (msx3), mRNA. (2029 bp)
misc_feature order(565..579,583..585,634..636,652..654,691..693, 697..702,709..714,718..726,730..735) /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 571..732 /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(571..573,580..582,700..702,709..714,721..723) /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="specific DNA base contacts...
Synonym: homeobox; msh-C; mshC; msx-c; msxc; zgc:86596
NM_131272.2 - Danio rerio (zebrafish) - NCBI - UCSC
Arabidopsis thaliana homeobox 53 (HB53), mRNA. (941 bp)
NA HOMEOBOX 53; ATHB53; HB-8; homeobox 53; HOMEOBOX-8; MSN2.9; MSN2_9" /inference="Similar to RNA sequence, EST:INSD:DR750230.1,INSD:DR229968.1,INSD:DR750666.1, INSD:DR750667.1" /inference="similar to RNA sequence, mRNA:INSD:BT024847.1,INSD:AY683477.1" /note="homeobox 53 (HB53); FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: response to auxin stimulus, regulation of transcription, DNA-dependent, root development; LOCATED IN: nucleus; EXPRESSED IN: 16 plant structures; EXPRESSED DURING: 8 growth stages; CONTAINS InterPro DOMAIN/s: Homeobox,...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX 53; ATHB53; HB-8; homeobox 53; HOMEOBOX-8; MSN2.9; MSN2_9
NM_126068.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox 3 (HB-3), mRNA. (1564 bp)
; HOMEOBOX PROTEIN" /note="Homeodomain; Region: HOX; smart00389" /db_xref="CDD:197696" misc_feature order(710..712,719..721,839..841,848..853,860..862) /gene="HB-3" /locus_tag="AT5G15150" /gene_synonym="ATHB-3; ATHB3; F8M21.40; F8M21_40; HAT7; homeobox 3; HOMEOBOX FROM ARABIDOPSIS THALIANA 7; HOMEOBOX PROTEIN" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 875..991 /gene="HB-3" /locus_tag="AT5G15150" /gene_synonym="ATHB-3; ATHB3; F8M21.40; F8M21_40; HAT7; homeobox 3; HOMEOBOX FROM ARABIDOPSIS THALIANA 7; HOMEOBOX PROTEIN" /note="Homeobox...
Synonym: ATHB-3; ATHB3; F8M21.40; F8M21_40; HAT7; homeobox 3; HOMEOBOX FROM ARABIDOPSIS THALIANA 7; HOMEOBOX PROTEIN
NM_121519.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox protein 22 (HB22), mRNA. (876 bp)
synonym="ARABIDOPSIS THALIANA HOMEOBOX PROTEIN 22; ATHB22; F13K3.1; F13K3_1; homeobox protein 22" /inference="Similar to RNA sequence, EST:INSD:DR751034.1,INSD:DR750769.1,INSD:DR750770.1" /inference="similar to RNA sequence, mRNA:INSD:DQ056569.1" /note="homeobox protein 22 (HB22); FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: regulation of transcription, DNA-dependent, regulation of transcription; LOCATED IN: nucleus; EXPRESSED IN: fruit; EXPRESSED DURING: seedling growth; CONTAINS InterPro DOMAIN/s: Homeobox, conserved site...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX PROTEIN 22; ATHB22; F13K3.1; F13K3_1; homeobox protein 22
NM_179935.2 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Rattus norvegicus Rhox homeobox family member 7 (Rhox7), mRNA. (900 bp)
Rhox homeobox family member 7" /protein_id="NP_001020825.1" /db_xref="GeneID:298353" /db_xref="RGD:1563189" /translation="MWFSNRRAKERACEKKAMPRSIPGAKAQMILPAGEGRNGEESERSSPGQEASATKWGEVEELGERDRTGSDGENLSAVGTSGIRNDWDKEGASSSRQKNESRPQKPVPECRWGMEDVQPVPVLIPRVQRIQLVQSRVQSVPLKVPTPRIRPVAVSATTVQPEPVLVPRRHLHDRFTDPELQELERERVFQRNHYLSAEERKELARVMGVSEAKVQRWFKKRREHFRREQSQSGGAPPGNTPPLSEDGAGALVYHP" misc_feature order(520..522,646..648,655..660,667..669) /gene="Rhox7" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 520..666 /gene="Rhox7" /note="Homeobox domain;...
NM_001025654.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Arabidopsis thaliana homeobox-leucine zipper protein 4 (HB4), mRNA. (1394 bp)
gene="HB4" /locus_tag="AT2G44910" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 4; ATHB-4; ATHB4; homeobox-leucine zipper protein 4; T13E15.8" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 702..854 /gene="HB4" /locus_tag="AT2G44910" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 4; ATHB-4; ATHB4; homeobox-leucine zipper protein 4; T13E15.8" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature 858..989 /gene="HB4" /locus_tag="AT2G44910" /gene_synonym="...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 4; ATHB-4; ATHB4; homeobox-leucine zipper protein 4; T13E15.8
NM_130055.2 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox-leucine zipper protein 17 (HB17), partial mRNA. (1018 bp)
synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5; homeobox-leucine zipper protein 17" /inference="Similar to RNA sequence, EST:INSD:DR751688.1,INSD:DR751625.1,INSD:DR751538.1, INSD:DR751539.1" /inference="similar to RNA sequence, mRNA:INSD:AJ431181.1" /note="homeobox-leucine zipper protein 17 (HB17); FUNCTIONS IN: sequence-specific DNA binding transcription factor activity; INVOLVED IN: regulation of transcription, DNA-dependent, regulation of transcription; LOCATED IN: nucleus; CONTAINS InterPro DOMAIN/s: Homeobox, conserved site...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5; homeobox-leucine zipper protein 17
NM_126204.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox protein 21 (HB21), mRNA. (1058 bp)
INSD:DR750746.1,INSD:DR750857.1,INSD:DR750745.1" /inference="similar to RNA sequence, mRNA:INSD:BT031362.1,INSD:BT031368.1" /note="homeobox protein 21 (HB21); FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: regulation of transcription, DNA-dependent, regulation of transcription; LOCATED IN: nucleus; EXPRESSED IN: 21 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Homeobox, conserved site (InterPro:IPR017970), Homeobox (InterPro:IPR001356), Homeodomain-like (InterPro:IPR009057), Helix-turn-helix motif, lambda...
Synonym: ATHB21; F24H14.10; F24H14_10; HB-2; homeobox protein 21; homeobox-2
NM_127411.2 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Gallus gallus Mix paired-like homeobox (MIXL1), mRNA. (886 bp)
t="homeobox protein MIXL1" /protein_id="NP_990321.1" /db_xref="CGNC:66215" /db_xref="GeneID:395838" /translation="MAALRFGPPPAELPAVPPSCPPGRWLCGTAGGSGGGPGAAPAPLASLPPAAEGAPSAQRRKRTSFTAAQLETLELVFQDTMYPDIYLRERLADATQIPESRIQVWFQNRRAKSRRQRGPPRPGAPAQRSPCGAAPLLRAREEHREWPPRAAGPPGSALRPHGGSGGAPAGPYPPRPAFPLPAGGGFSELGTEWEENAIGAFRAL" misc_feature order(176..190,194..196,245..247,263..265,302..304, 308..313,320..325,329..337,341..346) /gene="MIXL1" /gene_synonym="CMIX" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 182..343 /gene="MIXL1" /gene_synonym="CMIX" /note="Homeobox...
Synonym: CMIX
NM_204990.1 - Gallus gallus (chicken) - NCBI - UCSC
Arabidopsis thaliana homeobox-leucine zipper protein 17 (HB17), partial mRNA. (2359 bp)
on the 5' end. FEATURES Location/Qualifiers source 1..2359 /organism="Arabidopsis thaliana" /mol_type="mRNA" /db_xref="taxon:3702" /chromosome="2" /ecotype="Columbia" gene <1..2359 /gene="HB17" /locus_tag="AT2G01430" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5; homeobox-leucine zipper protein 17" /db_xref="Araport:AT2G01430" /db_xref="GeneID:814671" /db_xref="TAIR:AT2G01430" CDS 1..642 /gene="HB17" /locus_tag="AT2G01430" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5; homeobox-...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX-LEUCINE ZIPPER PROTEIN 17; ATHB-17; ATHB17; F2I9.5; F2I9_5; homeobox-leucine zipper protein 17
NM_001335062.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Rattus norvegicus Rhox homeobox family member 5 (Rhox5), mRNA. (636 bp)
organism="Rattus norvegicus" /mol_type="mRNA" /db_xref="taxon:10116" /chromosome="X" /map="Xq35" gene 1..636 /gene="Rhox5" /gene_synonym="Pem" /note="Rhox homeobox family member 5" /db_xref="GeneID:24631" /db_xref="RGD:3295" CDS 1..636 /gene="Rhox5" /gene_synonym="Pem" /note="homeobox protein Pem; reproductive homeobox on chromosome X 5; placenta and embryonic expression protein; placentae and embryos oncofetal; Homeobox gene Pem; reproductive homeobox 5" /codon_start=1 /product="homeobox protein Rhox5" /protein_id="NP_071511.1" /db_xref="GeneID:24631" /db_xref="RGD:3295" /translation="...
Synonym: Pem
NM_022175.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Arabidopsis thaliana homeobox 7 (HB-7), mRNA. (1308 bp)
ARABIDOPSIS THALIANA HOMEOBOX 7; ATHB-7; ATHB7; homeobox 7; T3A4.6" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(270..272,279..281,399..401,408..413,420..422) /gene="HB-7" /locus_tag="AT2G46680" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX 7; ATHB-7; ATHB7; homeobox 7; T3A4.6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 279..431 /gene="HB-7" /locus_tag="AT2G46680" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX 7; ATHB-7; ATHB7; homeobox 7; T3A4.6" /note="Homeobox domain; Region: Homeobox;...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX 7; ATHB-7; ATHB7; homeobox 7; T3A4.6
NM_001036473.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Rattus norvegicus homeo box A4 (Hoxa4), mRNA. (1518 bp)
gene="Hoxa4" /gene_synonym="hox1.4; Hox1r2" /note="homeo box A4" /db_xref="GeneID:100912525" /db_xref="RGD:2814" exon 1..515 /gene="Hoxa4" /gene_synonym="hox1.4; Hox1r2" /inference="alignment:Splign:2.1.0" CDS 5..862 /gene="Hoxa4" /gene_synonym="hox1.4; Hox1r2" /note="homeobox protein Hox-A4-like; Homeobox gene A4; homeobox protein R2; homeobox A4-like" /codon_start=1 /product="homeobox protein Hox-A4" /protein_id="NP_077326.1" /db_xref="GeneID:100912525" /db_xref="RGD:2814" /translation="...
Synonym: hox1.4; Hox1r2
NM_024350.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Arabidopsis thaliana WUSCHEL related homeobox 10 (WOX10), partial mRNA. (594 bp)
db_xref="TAIR:AT1G20710" CDS 1..594 /gene="WOX10" /locus_tag="AT1G20710" /gene_synonym="F2D10.20; F2D10_20; WOX13B; WUSCHEL related homeobox 10; WUSCHEL related homeobox 13B" /note="WUSCHEL related homeobox 10 (WOX10); FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: regulation of transcription, DNA-dependent, regulation of transcription; LOCATED IN: nucleus; CONTAINS InterPro DOMAIN/s: Homeobox (InterPro:IPR001356), Homeodomain-like (InterPro:IPR009057), Homeodomain-related (InterPro:IPR012287); BEST Arabidopsis thaliana protein match is:...
Synonym: F2D10.20; F2D10_20; WOX13B; WUSCHEL related homeobox 10; WUSCHEL related homeobox 13B
NM_101923.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Papio anubis homeobox A10 (HOXA10), mRNA. (282 bp)
gene="HOXA10" /note="homeobox A10" /db_xref="GeneID:100137570" CDS 1..282 /gene="HOXA10" /note="homeobox A10, isoform 1" /codon_start=1 /product="homeobox protein Hox-A10" /protein_id="NP_001162536.1" /db_xref="GeneID:100137570" /translation="MPGNSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS" misc_feature order(58..72,76..78,127..129,145..147,184..186,190..195, 202..207,211..219,223..228) /gene="HOXA10" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 64..225 /gene="HOXA10" /note="Homeobox domain; Region: Homeobox;...
NM_001169065.1 - Papio anubis (olive baboon) - NCBI
Arabidopsis thaliana WUSCHEL related homeobox 5 (WOX5), mRNA. (1052 bp)
WUSCHEL related homeobox 5; WUSCHEL related homeobox 5B" /note="Arabidopsis thaliana WOX5 protein mRNA" /db_xref="Araport:AT3G11260" /db_xref="GeneID:820297" /db_xref="TAIR:AT3G11260" CDS 327..875 /gene="WOX5" /locus_tag="AT3G11260" /gene_synonym="WOX5B; WUSCHEL related homeobox 5; WUSCHEL related homeobox 5B" /inference="Similar to RNA sequence, EST:INSD:DR750862.1,INSD:DR751206.1,INSD:DR750861.1, INSD:EH977836.1" /inference="Similar to RNA sequence, mRNA:INSD:AY150812.1,INSD:AY251398.1" /note="WUSCHEL related homeobox 5 (WOX5); CONTAINS InterPro DOMAIN/s: Homeobox (InterPro:IPR001356),...
Synonym: WOX5B; WUSCHEL related homeobox 5; WUSCHEL related homeobox 5B
NM_111961.4 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Rattus norvegicus SEBOX homeobox (Sebox), mRNA. (567 bp)
LOCUS NM_023951 567 bp mRNA linear ROD 07-JUN-2019 DEFINITION Rattus norvegicus SEBOX homeobox (Sebox), mRNA. ACCESSION NM_023951 VERSION NM_023951.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...Og9x" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 61..216 /gene="Sebox" /gene_synonym="Og9x" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(61..63,70..72,190..192,199..204,211..213) /gene="Sebox" /gene_synonym="Og9x...
Synonym: Og9x
NM_023951.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Arabidopsis thaliana WUSCHEL related homeobox 7 (WOX7), partial mRNA. (429 bp)
TAIR:AT5G05770" CDS 61..429 /gene="WOX7" /locus_tag="AT5G05770" /gene_synonym="MJJ3.18; MJJ3_18; WOX5A; WUSCHEL related homeobox 5A; WUSCHEL related homeobox 7" /inference="Similar to RNA sequence, EST:INSD:DR750916.1,INSD:DR751352.1,INSD:DR750917.1" /note="WUSCHEL related homeobox 7 (WOX7); FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: regulation of transcription, DNA-dependent; CONTAINS InterPro DOMAIN/s: Homeobox (InterPro:IPR001356), Homeodomain-like (InterPro:IPR009057); BEST Arabidopsis thaliana protein match is: WUSCHEL related...
Synonym: MJJ3.18; MJJ3_18; WOX5A; WUSCHEL related homeobox 5A; WUSCHEL related homeobox 7
NM_120659.2 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Gallus gallus homeobox D12 (HOXD12), mRNA. (1419 bp)
LOCUS NM_205249 1419 bp mRNA linear VRT 03-AUG-2019 DEFINITION Gallus gallus homeobox D12 (HOXD12), mRNA. ACCESSION NM_205249 VERSION NM_205249.1 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria;...gene="HOXD12" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 676..837 /gene="HOXD12" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(676..678,685..687,805..807,814..819,826..828) /gene="HOXD12" /note="specific DNA base...
NM_205249.1 - Gallus gallus (chicken) - NCBI - UCSC
Arabidopsis thaliana homeobox-leucine zipper protein 3 (HAT3), mRNA. (1447 bp)
locus_tag="AT3G60390" /gene_synonym="HOMEOBOX PROTEIN; homeobox-leucine zipper protein 3" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(775..777,784..786,904..906,913..918,925..927) /gene="HAT3" /locus_tag="AT3G60390" /gene_synonym="HOMEOBOX PROTEIN; homeobox-leucine zipper protein 3" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 784..936 /gene="HAT3" /locus_tag="AT3G60390" /gene_synonym="HOMEOBOX PROTEIN; homeobox-leucine zipper protein 3" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_...
Synonym: HOMEOBOX PROTEIN; homeobox-leucine zipper protein 3
NM_115903.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana homeobox 7 (HB-7), mRNA. (1474 bp)
ARABIDOPSIS THALIANA HOMEOBOX 7; ATHB-7; ATHB7; homeobox 7; T3A4.6" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(288..290,297..299,417..419,426..431,438..440) /gene="HB-7" /locus_tag="AT2G46680" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX 7; ATHB-7; ATHB7; homeobox 7; T3A4.6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 297..449 /gene="HB-7" /locus_tag="AT2G46680" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX 7; ATHB-7; ATHB7; homeobox 7; T3A4.6" /note="Homeobox domain; Region: Homeobox;...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX 7; ATHB-7; ATHB7; homeobox 7; T3A4.6
NM_130233.5 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana WUSCHEL related homeobox 14 (WOX14), partial mRNA. (826 bp)
xref="GeneID:838660" /db_xref="TAIR:AT1G20700" CDS 1..636 /gene="WOX14" /locus_tag="AT1G20700" /gene_synonym="ATWOX14; F2D10.19; F2D10_19; WUSCHEL related homeobox 14; WUSCHEL RELATED HOMEOBOX 14" /inference="Similar to RNA sequence, EST:INSD:DR751559.1,INSD:AA585837.1,INSD:T22843.1, INSD:DR751560.1" /inference="similar to RNA sequence, mRNA:INSD:AJ441297.1" /note="WUSCHEL related homeobox 14 (WOX14); CONTAINS InterPro DOMAIN/s: Homeobox (InterPro:IPR001356), Homeodomain-like (InterPro:IPR009057), Homeodomain-related (InterPro:IPR012287); BEST Arabidopsis thaliana protein match is: WUSCHEL...
Synonym: ATWOX14; F2D10.19; F2D10_19; WUSCHEL related homeobox 14; WUSCHEL RELATED HOMEOBOX 14
NM_101922.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Bos taurus retina and anterior neural fold homeobox 2 (RAX2), mRNA. (1828 bp)
gene="RAX2" /gene_synonym="QRX" /note="Region: homeobox domain" misc_feature order(130..144,148..150,199..201,217..219,256..258, 262..267,274..279,283..291,295..300) /gene="RAX2" /gene_synonym="QRX" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(136..138,145..147,265..267,274..279,286..288) /gene="RAX2" /gene_synonym="QRX" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 139..297 /gene="RAX2" /gene_synonym="QRX" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN //...
Synonym: QRX
NM_182653.1 - Bos taurus (cattle) - NCBI
Gallus gallus msh homeobox 1 (MSX1), mRNA. (1312 bp)
LOCUS NM_205488 1312 bp mRNA linear VRT 21-SEP-2019 DEFINITION Gallus gallus msh homeobox 1 (MSX1), mRNA. ACCESSION NM_205488 XM_444660 VERSION NM_205488.2 KEYWORDS RefSeq. SOURCE Gallus gallus (chicken) ORGANISM Gallus gallus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 569..730 /gene="MSX1" /gene_synonym="CHOX-7; GHOX-7; HOX-7" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(569..571,578..580,698..700,707..712,719..721) /gene="MSX1" /gene_synonym...
Synonym: CHOX-7; GHOX-7; HOX-7
NM_205488.2 - Gallus gallus (chicken) - NCBI - UCSC
Arabidopsis thaliana homeobox 12 (HB-12), mRNA. (1054 bp)
." /codon_start=1 /product="homeobox 12" /protein_id="NP_191748.1" /db_xref="GeneID:825362" /db_xref="TAIR:AT3G61890" /db_xref="Araport:AT3G61890" /translation="MEEGDFFNCCFSEISSGMTMNKKKMKKSNNQKRFSEEQIKSLELIFESETRLEPRKKVQVARELGLQPRQVAIWFQNKRARWKTKQLEKEYNTLRANYNNLASQFEIMKKEKQSLVSELQRLNEEMQRPKEEKHHECCGDQGLALSSSTESHNGKSEPEGRLDQGSVLCNDGDYNNNIKTEYFGFEEETDHELMNIVEKADDSCLTSSENWGGFNSDSLLDQSSSNYPNWWEFWS" misc_feature 251..403 /gene="HB-12" /locus_tag="AT3G61890" /gene_synonym="ARABIDOPSIS THALIANA HOMEOBOX 12; ATHB-12; ATHB12; homeobox 12" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_...
Synonym: ARABIDOPSIS THALIANA HOMEOBOX 12; ATHB-12; ATHB12; homeobox 12
NM_116054.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Arabidopsis thaliana WUSCHEL related homeobox 8 (WOX8), mRNA. (1151 bp)
db_xref="TAIR:AT5G45980" CDS 36..1013 /gene="WOX8" /locus_tag="AT5G45980" /gene_synonym="MCL19.2; MCL19_2; STIMPY-LIKE; STPL; WOX9B; WUSCHEL related homeobox 8; WUSCHEL related homeobox 9B" /inference="Similar to RNA sequence, EST:INSD:DR750890.1,INSD:AV557790.1,INSD:DR750889.1, INSD:AV556647.1" /inference="similar to RNA sequence, mRNA:INSD:AY251400.1" /note="WUSCHEL related homeobox 8 (WOX8); CONTAINS InterPro DOMAIN/s: Homeobox (InterPro:IPR001356), Homeodomain-like (InterPro:IPR009057); BEST Arabidopsis thaliana protein match is: homeobox-3 (TAIR:AT2G33880.1); Has 568 Blast hits to 538...
Synonym: MCL19.2; MCL19_2; STIMPY-LIKE; STPL; WOX9B; WUSCHEL related homeobox 8; WUSCHEL related homeobox 9B
NM_123966.3 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Mus musculus msh homeobox 2 (Msx2), mRNA. (2162 bp)
LOCUS NM_013601 2162 bp mRNA linear ROD 27-OCT-2019 DEFINITION Mus musculus msh homeobox 2 (Msx2), mRNA. ACCESSION NM_013601 VERSION NM_013601.2 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;...binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 503..664 /gene="Msx2" /gene_synonym="BB122635; Hox-8; Hox8; Hox8.1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(503..505,512..514,632..634,641..646,653..655) /gene="Msx2" /gene_...
Synonym: BB122635; Hox-8; Hox8; Hox8.1
NM_013601.2 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Papio anubis homeobox A7 (HOXA7), mRNA. (693 bp)
LOCUS NM_001168898 693 bp mRNA linear PRI 31-JUL-2017 DEFINITION Papio anubis homeobox A7 (HOXA7), mRNA. ACCESSION NM_001168898 VERSION NM_001168898.1 KEYWORDS RefSeq. SOURCE Papio anubis (olive baboon) ORGANISM Papio anubis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia...HOXA7" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 400..561 /gene="HOXA7" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:333795" ORIGIN //...
NM_001168898.1 - Papio anubis (olive baboon) - NCBI
Arabidopsis thaliana WUSCHEL related homeobox 14 (WOX14), mRNA. (1365 bp)
. FEATURES Location/Qualifiers source 1..1365 /organism="Arabidopsis thaliana" /mol_type="mRNA" /db_xref="taxon:3702" /chromosome="1" /ecotype="Columbia" gene 1..1365 /gene="WOX14" /locus_tag="AT1G20700" /gene_synonym="ATWOX14; F2D10.19; F2D10_19; WUSCHEL related homeobox 14; WUSCHEL RELATED HOMEOBOX 14" /note="Encodes WOX14, a WUSCHEL-related homeobox gene family member with 65 amino acids in its homeodomain. Proteins in this family contain a sequence of eight residues (TLPLFPMH) downstream of the homeodomain called the WUS box. Functions in the shoot meristem organizing center to...
Synonym: ATWOX14; F2D10.19; F2D10_19; WUSCHEL related homeobox 14; WUSCHEL RELATED HOMEOBOX 14
NM_001332460.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Oryctolagus cuniculus homeobox A6 (HOXA6), mRNA. (684 bp)
LOCUS NM_001171401 684 bp mRNA linear MAM 30-AUG-2012 DEFINITION Oryctolagus cuniculus homeobox A6 (HOXA6), mRNA. ACCESSION NM_001171401 VERSION NM_001171401.1 KEYWORDS RefSeq. SOURCE Oryctolagus cuniculus (rabbit) ORGANISM Oryctolagus cuniculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...HOXA6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 466..624 /gene="HOXA6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN //...
NM_001171401.1 - Oryctolagus cuniculus (rabbit) - NCBI
Arabidopsis thaliana WUSCHEL related homeobox 14 (WOX14), partial mRNA. (866 bp)
on the 5' end. FEATURES Location/Qualifiers source 1..866 /organism="Arabidopsis thaliana" /mol_type="mRNA" /db_xref="taxon:3702" /chromosome="1" /ecotype="Columbia" gene <1..866 /gene="WOX14" /locus_tag="AT1G20700" /gene_synonym="ATWOX14; F2D10.19; F2D10_19; WUSCHEL related homeobox 14; WUSCHEL RELATED HOMEOBOX 14" /note="Encodes WOX14, a WUSCHEL-related homeobox gene family member with 65 amino acids in its homeodomain. Proteins in this family contain a sequence of eight residues (TLPLFPMH) downstream of the homeodomain called the WUS box. Functions in the shoot meristem organizing center to...
Synonym: ATWOX14; F2D10.19; F2D10_19; WUSCHEL related homeobox 14; WUSCHEL RELATED HOMEOBOX 14
NM_001332461.1 - Arabidopsis thaliana (thale cress) - NCBI - TAIR
Homo sapiens double homeobox 5 (DUX5), mRNA. (594 bp)
DUX5" /gene_synonym="DUX1" /note="double homeobox protein; alternative translation start site; double homeobox protein 1" /codon_start=1 /product="double homeobox protein 5" /protein_id="NP_036281.2" /db_xref="GeneID:26581" /db_xref="HGNC:HGNC:3083" /db_xref="MIM:611444" /translation="MPAEVHGSPPASLCPCQSVKFRPGLPEMALLTALDDTLPEEAQGPGRRMILLSTPSQSDALRACFERNLYPGIATKEELAQGIDIPEPRVQIWFQNERSCQLRQHRRQSRPWPGRRDPQKGRRKRTAITGSQTALLLRAFEKDRFPGIAAREELARETGLPESRIQIWFQNRRARHRGQSGRAPTQASIRCNAAPIG" misc_feature 160..297 /gene="DUX5" /gene_synonym="DUX1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_...
Synonym: DUX1
NM_012149.2 - Homo sapiens (human) - NCBI - UCSC - RefEx(expression)
Gallus gallus goosecoid homeobox (GSC), mRNA. (936 bp)
ct="homeobox protein goosecoid" /protein_id="NP_990662.1" /db_xref="CGNC:8338" /db_xref="GeneID:396273" /translation="MPASMFSIDNILAARPRCKDSVLLPPSAPVVFPSLHGDSLYGAASDYGGFYSRAVAPGSALPAVGRSRLGYNNYYYGQLHVATSPVGPSCCGAVPPLGAQQCSCVPPAGYEGAGSVLMSPVPHQMLPYMNVGTLSRTELQLLNQLHCRRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRQKRSSSEESENAQKWNKASKTSPEKRQEDGKSDLDSDS" misc_feature order(451..465,469..471,520..522,538..540,577..579, 583..588,595..600,604..612,616..621) /gene="GSC" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 457..618 /gene="GSC" /note="Homeobox...
NM_205331.1 - Gallus gallus (chicken) - NCBI - UCSC
Xenopus laevis VENT homeobox 3, gene 2 S homeolog (ventx3.2.S), mRNA. (1072 bp)
LOCUS NM_001088485 1072 bp mRNA linear VRT 24-SEP-2019 DEFINITION Xenopus laevis VENT homeobox 3, gene 2 S homeolog (ventx3.2.S), mRNA. ACCESSION NM_001088485 NM_001088486 VERSION NM_001088485.1 KEYWORDS RefSeq. SOURCE Xenopus laevis (African clawed frog) ORGANISM Xenopus laevis Eukaryota; Metazoa;...; other site" /db_xref="CDD:238039" misc_feature 448..606 /gene="ventx3.2.S" /gene_synonym="ventx3.2; vex1; xvex-1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 308..567 /gene="ventx3.2.S" /gene_synonym="ventx3.2; vex1; xvex-1" /inference="...
Synonym: ventx3.2; vex1; xvex-1
NM_001088485.1 - Xenopus laevis (African clawed frog) - NCBI
Mus musculus homeobox gene expressed in ES cells (Hesx1), mRNA. (1144 bp)
LOCUS NM_010420 1144 bp mRNA linear ROD 20-OCT-2019 DEFINITION Mus musculus homeobox gene expressed in ES cells (Hesx1), mRNA. ACCESSION NM_010420 VERSION NM_010420.2 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...Rpx" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 689..850 /gene="Hesx1" /gene_synonym="HES-1; Rpx" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(689..691,698..700,818..820,827..832,839..841) /gene="Hesx1" /gene_...
Synonym: HES-1; Rpx
NM_010420.2 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Salmo salar distal-less homeobox gene 3b (dlx3b), mRNA. (1221 bp)
mRNA" /db_xref="taxon:8030" gene 1..1221 /gene="dlx3b" /note="distal-less homeobox gene 3b" /db_xref="GeneID:100195799" CDS 160..777 /gene="dlx3b" /codon_start=1 /product="homeobox protein Dlx3b" /protein_id="NP_001134300.1" /db_xref="GeneID:100195799" /translation="MMSGQIYEKKIASILTDLPGSMSCHPSSKDSPTLPESSVTDMGYYSGQTAHSHHEYYQSQTYGQQMNAYHHQFNLNGMGGAGVYPTKSEYPYTNAYRQYGHYNRDHLQASPQSSVKEEPEPEVRMVNGKPKKIRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNSKALGLFINKD" misc_feature 244..495 /gene="dlx3b" /note="Homeobox protein distal-less-like N terminal; Region: DLL_N; pfam12413" /db_xref="...
NM_001140828.1 - Salmo salar (Atlantic salmon) - NCBI
Rattus norvegicus homeobox C8 (Hoxc8), mRNA. (1228 bp)
FEATURES Location/Qualifiers source 1..1228 /organism="Rattus norvegicus" /mol_type="mRNA" /strain="BN" /db_xref="taxon:10116" /chromosome="7" /map="7q36" gene 1..1228 /gene="Hoxc8" /gene_synonym="Hox3r4" /note="homeobox C8" /db_xref="GeneID:24460" /db_xref="RGD:2821" CDS 1..729 /gene="Hoxc8" /gene_synonym="Hox3r4" /note="homeobox protein R4; Homeobox gene C8; homeo box C8" /codon_start=1 /product="homeobox protein Hox-C8" /protein_id="NP_001170797.2" /db_xref="GeneID:24460" /db_xref="RGD:2821" /translation="...
Synonym: Hox3r4
NM_001177326.2 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus H2.0-like homeobox (Hlx), mRNA. (2141 bp)
CDD:238039" misc_feature 1148..1309 /gene="Hlx" /gene_synonym="Hlx1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" exon 906..1085 /gene="Hlx" /gene_synonym="Hlx1" /inference="alignment:Splign:2.0.8" exon 1086..1270 /gene="Hlx" /gene_synonym="Hlx1" /inference="alignment:Splign:2.0.8" exon 1271..2116 /gene="Hlx" /gene_synonym="Hlx1" /inference="alignment:Splign:2.0.8" ORIGIN // REFERENCE 1 (bases 1 to 2141) AUTHORS Bates MD, Dunagan DT, Welch LC, Kaul A and Harvey RP. TITLE The Hlx homeobox transcription factor is required early in enteric nervous system development...
Synonym: Hlx1
NM_001077674.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Rattus norvegicus mesenchyme homeobox 2 (Meox2), mRNA. (2244 bp)
LOCUS NM_017149 2244 bp mRNA linear ROD 23-SEP-2019 DEFINITION Rattus norvegicus mesenchyme homeobox 2 (Meox2), mRNA. ACCESSION NM_017149 VERSION NM_017149.1 KEYWORDS RefSeq. SOURCE Rattus norvegicus (Norway rat) ORGANISM Rattus norvegicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...Meox2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 764..922 /gene="Meox2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 2244) AUTHORS Liu P, Feng J, Kong F, Lu Q, Xu H, Meng J...
NM_017149.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Macaca mulatta msh homeobox 1 (MSX1), mRNA. (1574 bp)
LOCUS NM_001040416 1574 bp mRNA linear PRI 23-OCT-2019 DEFINITION Macaca mulatta msh homeobox 1 (MSX1), mRNA. ACCESSION NM_001040416 VERSION NM_001040416.2 KEYWORDS RefSeq. SOURCE Macaca mulatta (Rhesus monkey) ORGANISM Macaca mulatta Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi...gene="MSX1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 770..931 /gene="MSX1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(770..772,779..781,899..901,908..913,920..922) /gene="MSX1" /note="specific DNA base...
NM_001040416.2 - Macaca mulatta (Rhesus monkey) - NCBI
Oncorhynchus mykiss caudal-type homeobox protein 1 (cdx1), mRNA. (1497 bp)
cdx1" /inference="non-experimental evidence, no additional details recorded" /note="Region: homeobox" misc_feature order(545..556,560..562,611..613,629..631,668..670, 674..679,686..691,695..703,707..712) /gene="cdx1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature order(548..550,557..559,677..679,686..691,698..700) /gene="cdx1" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 551..709 /gene="cdx1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature 563..607 /gene="cdx1" /...
NM_001124632.1 - Oncorhynchus mykiss (rainbow trout) - NCBI
Mus musculus msh homeobox 1 (Msx1), mRNA. (1931 bp)
LOCUS NM_010835 1931 bp mRNA linear ROD 01-OCT-2019 DEFINITION Mus musculus msh homeobox 1 (Msx1), mRNA. ACCESSION NM_010835 VERSION NM_010835.2 KEYWORDS RefSeq. SOURCE Mus musculus (house mouse) ORGANISM Mus musculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;..." /db_xref="CDD:238039" misc_feature 775..936 /gene="Msx1" /gene_synonym="AA675338; AI324650; Hox-7; Hox7; Hox7.1; msh" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(775..777,784..786,904..906,913..918,925..927) /gene="Msx1" /gene_synonym="...
Synonym: AA675338; AI324650; Hox-7; Hox7; Hox7.1; msh
NM_010835.2 - Mus musculus (house mouse) - NCBI - UCSC - RefEx(expression)
Zea mays homeobox-leucine zipper protein ATHB-6 (LOC100285460), mRNA. (932 bp)
="homeobox-leucine zipper protein ATHB-6" /protein_id="NP_001151825.1" /db_xref="GeneID:100285460" /translation="MERGDCQFTVVPPRQYDEAQFMHQLMAAGDQQDPAGAGRGAAGGGGERKRRFTEEQVRSLETTFHARRAKLEPREKAELARELGLQPRQVAIWFQNKRARWRSKQLEHDYAALRAQFDAMHARVESLRQEKIALAAQVDELRGRLNERQDQSGSCEVNDAEAAADDKRNNSTSSLVQDDGATPPPAAVDASEDSAATGEYYDHVAYEYDGLHDPFVCATPDLWDTWPLLEWNAVA" misc_feature order(260..268,272..274,326..328,344..346,383..385, 389..394,401..406,410..418,422..427) /gene="LOC100285460" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 260..424 /gene="LOC100285460" /note="Homeobox...
NM_001158353.1 - Zea mays - NCBI

Data Export:

下記より最大10000件まで検索結果を取得できます。

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/ja/homeobox
lang : ja | div : | spe : | query_string : homeobox | format : html | download :

0.000 | 0.000 | search_start;
0.198 | 0.198 | count_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=0&format=json
0.356 | 0.158 | search_done; http://172.18.8.71:7700/v1/refseq/query?q=((full_search:*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.362 | 0.007 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]