GGRNA ver.2 Help | Advanced search | English    旧バージョン

2017-10-21 02:45:39, GGRNA : RefSeq release 84 (Sep, 2017)

Summary:

Results:

検索語に色がつきます重なると色が濃く表示されます。

Danio rerio muscle segment homeobox 3 (msx3), mRNA. (2029 bp)
misc_feature order(565..579,583..585,634..636,652..654,691..693, 697..702,709..714,718..726,730..735) /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 571..732 /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(571..573,580..582,700..702,709..714,721..723) /gene="msx3" /gene_synonym="homeobox; msh-C; mshC; msx-c; msxc; zgc:86596" /note="specific DNA base contacts...
Synonym: homeobox; msh-C; mshC; msx-c; msxc; zgc:86596
NM_131272.2 - Danio rerio (zebrafish) - NCBI - UCSC
Danio rerio ladybird homeobox 2 (lbx2), mRNA. (1764 bp)
misc_feature order(688..702,706..708,757..759,775..777,814..816, 820..825,832..837,841..849,853..858) /gene="lbx2" /gene_synonym="fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 694..855 /gene="lbx2" /gene_synonym="fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(694..696,703..705,823..825,832..837,844..846) /gene="lbx2" /gene_synonym="fc26c12; homeobox; lbx; lbx1;...
Synonym: fc26c12; homeobox; lbx; lbx1; lbx1h; SI:zC207O21.2; wu:fc26c12; zgc:92170
NM_001007134.1 - Danio rerio (zebrafish) - NCBI - UCSC
Zea mays homeobox 3 (hox3), mRNA. (5334 bp)
LOCUS NM_001309211 5334 bp mRNA linear PLN 07-SEP-2017 DEFINITION Zea mays homeobox 3 (hox3), mRNA. ACCESSION NM_001309211 XM_008675214 VERSION NM_001309211.1 KEYWORDS RefSeq. SOURCE Zea mays ORGANISM Zea mays Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea. REFERENCE COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from LPUQ01001404.1. On May 21, 2015 this sequence...
Synonym: GRMZM2G314546; homeobox3; Hox2a
NM_001309211.1 - Zea mays - NCBI
Canis lupus familiaris msh homeobox 2 (MSX2), mRNA. (804 bp)
t="homeobox protein MSX-2" /protein_id="NP_001003098.1" /db_xref="GeneID:403663" /translation="MASPSKGSDLFSSDEEGPAALAGPGPGPGGAEGAAEERRVKVSSLPFSVEALMSDKKPPKGASPRPADSASAGAALRPLLLPGHGAREAPSPGPPGKPFEAASVKSESAEDGAAWMQEPGRYSPPPRHMSPTTCTLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPSGFSLPFPINSPLQAASIYGASYPFHRPVLPIPPVGLYATPVGYGMYHLS" misc_feature order(427..441,445..447,496..498,514..516,553..555, 559..564,571..576,580..588,592..597) /gene="MSX2" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 433..594 /gene="MSX2" /note="Homeobox...
NM_001003098.2 - Canis lupus familiaris (dog) - NCBI
Papio anubis homeobox A10 (HOXA10), mRNA. (282 bp)
gene="HOXA10" /note="homeobox A10" /db_xref="GeneID:100137570" CDS 1..282 /gene="HOXA10" /note="homeobox A10, isoform 1" /codon_start=1 /product="homeobox protein Hox-A10" /protein_id="NP_001162536.1" /db_xref="GeneID:100137570" /translation="MPGNSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS" misc_feature order(58..72,76..78,127..129,145..147,184..186,190..195, 202..207,211..219,223..228) /gene="HOXA10" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 64..225 /gene="HOXA10" /note="Homeobox domain; Region: Homeobox;...
NM_001169065.1 - Papio anubis (olive baboon) - NCBI
Saccoglossus kowalevskii dorsal root ganglia homeobox (drgx), mRNA. (1821 bp)
LOCUS NM_001165009 1821 bp mRNA linear INV 18-APR-2013 DEFINITION Saccoglossus kowalevskii dorsal root ganglia homeobox (drgx), mRNA. ACCESSION NM_001165009 VERSION NM_001165009.1 KEYWORDS RefSeq. SOURCE Saccoglossus kowalevskii ORGANISM Saccoglossus kowalevskii Eukaryota; Metazoa; Hemichordata;...gene="drgx" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 534..692 /gene="drgx" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN //...
NM_001165009.1 - Saccoglossus kowalevskii - NCBI
Oryctolagus cuniculus homeobox A6 (HOXA6), mRNA. (684 bp)
LOCUS NM_001171401 684 bp mRNA linear MAM 30-AUG-2012 DEFINITION Oryctolagus cuniculus homeobox A6 (HOXA6), mRNA. ACCESSION NM_001171401 VERSION NM_001171401.1 KEYWORDS RefSeq. SOURCE Oryctolagus cuniculus (rabbit) ORGANISM Oryctolagus cuniculus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...HOXA6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 466..624 /gene="HOXA6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" STS 8..75 /gene="HOXA6" /standard_name="Hoxa6" /db_xref="UniSTS:536644" ORIGIN //...
NM_001171401.1 - Oryctolagus cuniculus (rabbit) - NCBI
Rattus norvegicus Mix paired-like homeobox 1 (Mixl1), mRNA. (2342 bp)
product="homeobox protein MIXL1" /protein_id="NP_001099449.1" /db_xref="GeneID:289311" /db_xref="RGD:1310011" /translation="MAAAGSQQLQFAEGAAFPTFPAAHPGGQLLPAARPATGLPPAPPDSRAPAATPCFPSRGPRPAAQTPTGLDPPGPSKGSAAPSAPQRRKRTSFSSEQLQLLELVFRQTMYPDIHLRERLAALTLLPESRIQVWFQNRRAKSRRQSGKSFQPLSSRREDFLHRPAPGTEARCLKPQLPLEADVNHVLDSSMAGGGVCTSGSQGFETYSSLSEDIGSKLDSWEEHIFSALGSF" misc_feature order(281..295,299..301,350..352,368..370,407..409, 413..418,425..430,434..442,446..451) /gene="Mixl1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 287..448 /gene="Mixl1" /note="Homeobox domain...
NM_001105979.1 - Rattus norvegicus (Norway rat) - NCBI - UCSC - RefEx(expression)
Saccoglossus kowalevskii homeobox 6 (hox6), mRNA. (2158 bp)
LOCUS NM_001164939 2158 bp mRNA linear INV 18-APR-2013 DEFINITION Saccoglossus kowalevskii homeobox 6 (hox6), mRNA. ACCESSION NM_001164939 VERSION NM_001164939.1 KEYWORDS RefSeq. SOURCE Saccoglossus kowalevskii ORGANISM Saccoglossus kowalevskii Eukaryota; Metazoa; Hemichordata; Enteropneusta;...gene="hox6" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 487..645 /gene="hox6" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 2158) AUTHORS Aronowicz,J. and Lowe,C.J. TITLE Hox...
NM_001164939.1 - Saccoglossus kowalevskii - NCBI
Salmo salar distal-less homeobox gene 3b (dlx3b), mRNA. (1221 bp)
mRNA" /db_xref="taxon:8030" gene 1..1221 /gene="dlx3b" /note="distal-less homeobox gene 3b" /db_xref="GeneID:100195799" CDS 160..777 /gene="dlx3b" /codon_start=1 /product="homeobox protein Dlx3b" /protein_id="NP_001134300.1" /db_xref="GeneID:100195799" /translation="MMSGQIYEKKIASILTDLPGSMSCHPSSKDSPTLPESSVTDMGYYSGQTAHSHHEYYQSQTYGQQMNAYHHQFNLNGMGGAGVYPTKSEYPYTNAYRQYGHYNRDHLQASPQSSVKEEPEPEVRMVNGKPKKIRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNSKALGLFINKD" misc_feature 244..495 /gene="dlx3b" /note="Homeobox protein distal-less-like N terminal; Region: DLL_N; pfam12413" /db_xref="...
NM_001140828.1 - Salmo salar (Atlantic salmon) - NCBI
Takifugu rubripes paired homeobox protein (pox1), mRNA. (1419 bp)
LOCUS NM_001032642 1419 bp mRNA linear VRT 18-APR-2013 DEFINITION Takifugu rubripes paired homeobox protein (pox1), mRNA. ACCESSION NM_001032642 VERSION NM_001032642.1 KEYWORDS RefSeq. SOURCE Takifugu rubripes (Fugu rubripes) ORGANISM Takifugu rubripes Eukaryota; Metazoa; Chordata; Craniata;...gene="pox1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 219..380 /gene="pox1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(219..221,228..230,348..350,357..362,369..371) /gene="pox1" /note="specific DNA base...
NM_001032642.1 - Takifugu rubripes (Fugu rubripes) - NCBI
Pan troglodytes msh homeobox 1 (MSX1), mRNA. (1932 bp)
gene="MSX1" /note="msh homeobox 1-like protein" /codon_start=1 /product="homeobox protein MSX-1" /protein_id="NP_001182191.1" /db_xref="GeneID:461092" /db_xref="VGNC:VGNC:641" /translation="MAPAADMTSLPLGVKVEDSAFGKPAGGGAGQAPSAAAATAAAMGADEEGAKPKVSPSLLPFSVEALMADHRKPGAKESALAPSEGVQAAGGSAQPLGVPPGSLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKAESPEKPERTPWMQSPRFSPPPARRLSPPACTLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYGASGPFQRAALPVAPVGLYTAHVGYSMYHLT" mat_peptide 254..1144 /gene="MSX1" /product="Homeobox protein MSX-1" /experiment="experimental evidence,...
NM_001195262.2 - Pan troglodytes (chimpanzee) - NCBI
Entamoeba invadens IP1 homeobox protein knotted-1, putative (EIN_053630) mRNA, complete cds. (747 bp)
locus_tag="EIN_053630" /note="encoded by transcript EIN_053630A" /codon_start=1 /product="homeobox protein knotted-1, putative" /protein_id="XP_004259889.1" /db_xref="GeneID:14892326" /translation="MEPTQEVQKVLTECVNKTIDFDQYLKCFEQSLVRPSGDISDQSLMEKVQHVADLVTGEKLLRLNELVQIFNSQAEVLYLYYTSYYTQLVSLLDSQSQKRIVTQDERSYKISCLRALFGNIYSHLKLMFGSNVSSLAPRERKIPTFLSPQISVHSITSQSQPLSKITCKNSLVLSSTKPTKPIFKIDKIKTQSPKTQKIKPLLDWFVLHSNHPYPTEEQKERLGSECGMSPKQVGTWFSNKRNRNKNQN" misc_feature 610..711 /locus_tag="EIN_053630" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:283551" ORIGIN // REFERENCE 1...
XM_004259841.1 - Entamoeba invadens IP1 - NCBI
Oryzias latipes NK2 homeobox 5 (nkx2-5), mRNA. (963 bp)
K2 homeobox 5" /db_xref="GeneID:100125478" CDS 1..963 /gene="nkx2-5" /gene_synonym="nkx2.5" /codon_start=1 /product="homeobox protein Nkx-2.5" /protein_id="NP_001098382.1" /db_xref="GeneID:100125478" /translation="MFPSPSTSTPFSVKDILNLEQNQGVMVSSHEVSSRMDCCAVPTCMLARLKQEPLREMSSSTVTSMFGEEIHDSKASRAHALSFTSAFYGKVVMDMEMDKKSNEFEDERGKDDFGVRVELLEDSKPEDPDRPKPRRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDHLASVLKLTPTQVKIWFQNRRYKCKRQRQDQSLEMVSLPPPRRVSVPVLVRDGKPCLAADSTAYNPSYGMAPISHFTYNNYPAFSNYSSPTCNTNYACSYPQTMQPSSSSGNYMNFGDLNTVQNPFPSSNGSLHGIRTW" misc_feature 451..600 /gene="nkx2-5" /gene_synonym="nkx2.5" /note="Homeobox...
Synonym: nkx2.5
NM_001104912.1 - Oryzias latipes (Japanese medaka) - NCBI
Oncorhynchus mykiss hematopoietically expressed homeobox (hhex), mRNA. (1172 bp)
SAMD00041049 [ECO:0000348] ##Evidence-Data-END## FEATURES Location/Qualifiers source 1..1172 /organism="Oncorhynchus mykiss" /mol_type="mRNA" /db_xref="taxon:8022" gene 1..1172 /gene="hhex" /note="hematopoietically expressed homeobox" /db_xref="GeneID:100305190" misc_feature 95..97 /gene="hhex" /note="upstream in-frame stop codon" CDS 116..964 /gene="hhex" /note="Homeobox protein PRH" /codon_start=1 /product="hematopoietically-expressed homeobox protein hhex" /protein_id="NP_001158566.1" /db_xref="GeneID:100305190" /translation="...
NM_001165094.1 - Oncorhynchus mykiss (rainbow trout) - NCBI
Saccoglossus kowalevskii TGFB-induced factor homeobox 1 (tgif1), mRNA. (1822 bp)
LOCUS NM_001164980 1822 bp mRNA linear INV 18-APR-2013 DEFINITION Saccoglossus kowalevskii TGFB-induced factor homeobox 1 (tgif1), mRNA. ACCESSION NM_001164980 VERSION NM_001164980.1 KEYWORDS RefSeq. SOURCE Saccoglossus kowalevskii ORGANISM Saccoglossus kowalevskii Eukaryota; Metazoa; Hemichordata;...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 355..474 /gene="tgif1" /gene_synonym="tgif" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:283551" ORIGIN // REFERENCE 1 (bases 1 to 1822) AUTHORS Freeman,R.M. Jr., Wu,M., Cordonnier-...
Synonym: tgif
NM_001164980.1 - Saccoglossus kowalevskii - NCBI
Ixodes scapularis nk homeobox protein, putative, mRNA. (95 bp)
GeneID:8039835" /db_xref="VectorBase:ISCW012461" CDS 95 /locus_tag="IscW_ISCW012461" /note="encoded by transcript IscW_ISCW012461-RA" /codon_start=1 /product="nk homeobox protein, putative" /protein_id="XP_002413770.1" /db_xref="VectorBase:ISCW012461-PA" /db_xref="GeneID:8039835" /db_xref="VectorBase:ISCW012461" /translation="VDKYLSVSKRMELSATLNLTEVQIKTWFQNRR" misc_feature <4..95 /locus_tag="IscW_ISCW012461" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 95) AUTHORS Nene,V. CONSRTM Ixodes scapularis Genome Project TITLE Direct...
XM_002413725.1 - Ixodes scapularis (black-legged tick) - NCBI
Saccoglossus kowalevskii homeobox 9/10 (hox9/10), mRNA. (2551 bp)
LOCUS NM_001164940 2551 bp mRNA linear INV 18-APR-2013 DEFINITION Saccoglossus kowalevskii homeobox 9/10 (hox9/10), mRNA. ACCESSION NM_001164940 VERSION NM_001164940.1 KEYWORDS RefSeq. SOURCE Saccoglossus kowalevskii ORGANISM Saccoglossus kowalevskii Eukaryota; Metazoa; Hemichordata; Enteropneusta;...gene="hox9/10" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 1170..1331 /gene="hox9/10" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(1170..1172,1179..1181,1299..1301,1308..1313, 1320..1322) /gene="hox9/10" /note="...
NM_001164940.1 - Saccoglossus kowalevskii - NCBI
Saccoglossus kowalevskii homeobox 2 (hox2), mRNA. (3042 bp)
LOCUS NM_001164937 3042 bp mRNA linear INV 18-APR-2013 DEFINITION Saccoglossus kowalevskii homeobox 2 (hox2), mRNA. ACCESSION NM_001164937 VERSION NM_001164937.1 KEYWORDS RefSeq. SOURCE Saccoglossus kowalevskii ORGANISM Saccoglossus kowalevskii Eukaryota; Metazoa; Hemichordata; Enteropneusta;...gene="hox2" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 976..1134 /gene="hox2" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 3042) AUTHORS Aronowicz,J. and Lowe,C.J. TITLE Hox...
NM_001164937.1 - Saccoglossus kowalevskii - NCBI
Ixodes scapularis homeobox protein, putative, mRNA. (201 bp)
db_xref="VectorBase:ISCW020382" CDS 1..201 /locus_tag="IscW_ISCW020382" /note="encoded by transcript IscW_ISCW020382-RA" /codon_start=1 /product="homeobox protein, putative" /protein_id="XP_002402536.1" /db_xref="VectorBase:ISCW020382-PA" /db_xref="GeneID:8033067" /db_xref="VectorBase:ISCW020382" /translation="MGRYFSTFQKEQLTKAFVCNAYPDTAQQRTLAFRLGLTTEQVKVWFANKRTRDRKRAVLFPELRLF" misc_feature 13..162 /locus_tag="IscW_ISCW020382" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 201) AUTHORS Nene,V. CONSRTM Ixodes scapularis Genome Project...
XM_002402492.1 - Ixodes scapularis (black-legged tick) - NCBI
Ixodes scapularis homeobox protein mox, putative, mRNA. (180 bp)
db_xref="VectorBase:ISCW024860" CDS 180 /locus_tag="IscW_ISCW024860" /note="encoded by transcript IscW_ISCW024860-RA" /codon_start=1 /product="homeobox protein mox, putative" /protein_id="XP_002415595.1" /db_xref="VectorBase:ISCW024860-PA" /db_xref="GeneID:8042510" /db_xref="VectorBase:ISCW024860" /translation="PRKERTAFSKHQVQELESEFAQRNYLTRLRRYEIALALDLTERQVRALYELSTSCARKDA" misc_feature 13..>138 /locus_tag="IscW_ISCW024860" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 180) AUTHORS Nene,V. CONSRTM Ixodes scapularis Genome Project...
XM_002415550.1 - Ixodes scapularis (black-legged tick) - NCBI
Ixodes scapularis emx homeobox protein, putative, mRNA. (213 bp)
xref="VectorBase:ISCW012144" CDS 1..213 /locus_tag="IscW_ISCW012144" /note="encoded by transcript IscW_ISCW012144-RA" /codon_start=1 /product="emx homeobox protein, putative" /protein_id="XP_002414084.1" /db_xref="VectorBase:ISCW012144-PA" /db_xref="GeneID:8040230" /db_xref="VectorBase:ISCW012144" /translation="MPKEGPEPAGFLLHPFRKPKRIRTAFSPSQLLKLEHAFEKNHYVVGAERKQLAQSLSLTETQVEDARLSF" misc_feature 67..>189 /locus_tag="IscW_ISCW012144" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 213) AUTHORS Nene,V. CONSRTM Ixodes scapularis Genome...
XM_002414039.1 - Ixodes scapularis (black-legged tick) - NCBI
Papio anubis homeobox A7 (HOXA7), mRNA. (693 bp)
LOCUS NM_001168898 693 bp mRNA linear PRI 31-JUL-2017 DEFINITION Papio anubis homeobox A7 (HOXA7), mRNA. ACCESSION NM_001168898 VERSION NM_001168898.1 KEYWORDS RefSeq. SOURCE Papio anubis (olive baboon) ORGANISM Papio anubis Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia...HOXA7" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 400..558 /gene="HOXA7" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" STS 23..99 /gene="HOXA7" /standard_name="Hoxa7" /db_xref="UniSTS:536645" STS 64..365 /gene="...
NM_001168898.1 - Papio anubis (olive baboon) - NCBI
Salmo salar homeobox protein HoxB9ab (hoxb9ab), mRNA. (1216 bp)
LOCUS NM_001141626 1216 bp mRNA linear VRT 17-APR-2013 DEFINITION Salmo salar homeobox protein HoxB9ab (hoxb9ab), mRNA. ACCESSION NM_001141626 VERSION NM_001141626.1 KEYWORDS RefSeq. SOURCE Salmo salar (Atlantic salmon) ORGANISM Salmo salar Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...gene="hoxb9ab" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 651..812 /gene="hoxb9ab" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(651..653,660..662,780..782,789..794,801..803) /gene="hoxb9ab" /note="specific DNA...
NM_001141626.1 - Salmo salar (Atlantic salmon) - NCBI
Salmo salar homeobox protein HoxC11ab (hoxc11ab), mRNA. (1046 bp)
LOCUS NM_001141665 1046 bp mRNA linear VRT 17-APR-2013 DEFINITION Salmo salar homeobox protein HoxC11ab (hoxc11ab), mRNA. ACCESSION NM_001141665 VERSION NM_001141665.1 KEYWORDS RefSeq. SOURCE Salmo salar (Atlantic salmon) ORGANISM Salmo salar Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...gene="hoxc11ab" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 809..970 /gene="hoxc11ab" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(809..811,818..820,938..940,947..952,959..961) /gene="hoxc11ab" /note="specific DNA...
NM_001141665.1 - Salmo salar (Atlantic salmon) - NCBI
Xenopus tropicalis Mix paired homeobox (mixl1), mRNA. (1605 bp)
LOCUS NM_203517 1605 bp mRNA linear VRT 17-AUG-2017 DEFINITION Xenopus tropicalis Mix paired homeobox (mixl1), mRNA. ACCESSION NM_203517 VERSION NM_203517.1 KEYWORDS RefSeq. SOURCE Xenopus tropicalis (tropical clawed frog) ORGANISM Xenopus tropicalis Eukaryota; Metazoa; Chordata; Craniata;..." /db_xref="CDD:238039" misc_feature 328..489 /gene="mixl1" /gene_synonym="mild1; mix; mix.1; mix.2; mix1; mix2; mixl; tMix" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(328..330,337..339,457..459,466..471,478..480) /gene="mixl1" /gene_synonym...
Synonym: mild1; mix; mix.1; mix.2; mix1; mix2; mixl; tMix
NM_203517.1 - Xenopus tropicalis (tropical clawed frog) - NCBI
Oryzias latipes diencephalon/mesencephalon homeobox 1 (dmbx1), mRNA. (1305 bp)
LOCUS NM_001122932 1305 bp mRNA linear VRT 07-AUG-2017 DEFINITION Oryzias latipes diencephalon/mesencephalon homeobox 1 (dmbx1), mRNA. ACCESSION NM_001122932 VERSION NM_001122932.1 KEYWORDS RefSeq. SOURCE Oryzias latipes (Japanese medaka) ORGANISM Oryzias latipes Eukaryota; Metazoa; Chordata;...gene="dmbx1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 328..489 /gene="dmbx1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(328..330,337..339,457..459,466..471,478..480) /gene="dmbx1" /note="specific DNA base...
NM_001122932.1 - Oryzias latipes (Japanese medaka) - NCBI
Bos taurus orthopedia homeobox (OTP), mRNA. (2686 bp)
CDS 170..1147 /gene="OTP" /codon_start=1 /product="homeobox protein orthopedia" /protein_id="NP_001096782.1" /db_xref="GeneID:100125232" /translation="MLSHADLLDARLGMKDAAELLGHREAVKCRLGVGGSDPGGHPGDLAPNSDPVEGATLLPGEDITTVGSTPASLAVSAKDPDKQPGPQGGPNPSQAGQQQGQQKQKRHRTRFTPAQLNELERSFAKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTTNVFRAPGTLLPTPGLPQFPSMGDSLCSFHANDTRWAAAAMPGVSQLPLPPALGRQQAMAQSLSQCSLAAGPPPNSMGLSNSLAGSNGAGLQSHLYQPAFPGMVPASLPGPSNVSGSPQLCSSPDSSDVWRGTSIASLRRKALEHTVSMSFT" misc_feature 488..634 /gene="OTP" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order...
NM_001103312.1 - Bos taurus (cattle) - NCBI
Ixodes scapularis retinal homeobox protein, putative, mRNA. (384 bp)
locus_tag="IscW_ISCW014108" /note="encoded by transcript IscW_ISCW014108-RA" /codon_start=1 /product="retinal homeobox protein, putative" /protein_id="XP_002416102.1" /db_xref="VectorBase:ISCW014108-PA" /db_xref="GeneID:8043141" /db_xref="VectorBase:ISCW014108" /translation="MNDFRKHICTDFVERLAAESDLLRKIVTTGFELSSGPELSPGTGSRGSPGPEVAAPVTSECGQTPSANKKKHRRNRTTFTTFQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQVRTFS" misc_feature 241..>369 /locus_tag="IscW_ISCW014108" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 384) AUTHORS Nene,V. CONSRTM Ixodes...
XM_002416057.1 - Ixodes scapularis (black-legged tick) - NCBI
Mesocricetus auratus ALX homeobox 3 (Alx3), mRNA. (1744 bp)
Region: Homeobox; pfam00046" /db_xref="CDD:278475" STS 309..1061 /gene="Alx3" /standard_name="Alx3" /db_xref="UniSTS:547182" ORIGIN // REFERENCE 1 (bases 1 to 1744) AUTHORS McCann KE, Sinkiewicz DM, Norvelle A and Huhman KL. TITLE De novo assembly, annotation, and characterization of the whole brain transcriptome of male and female Syrian hamsters JOURNAL Sci Rep 7, 40472 (2017) PUBMED 28071753 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 1744) AUTHORS Rudnick A, Ling TY, Odagiri H, Rutter WJ and German MS. TITLE Pancreatic beta cells express a diverse set of homeobox genes...
NM_001281625.1 - Mesocricetus auratus (golden hamster) - NCBI
PREDICTED: Papio anubis divergent paired-related homeobox-like (LOC101021384), mRNA. (1634 bp)
with support for all annotated introns" /db_xref="GeneID:101021384" CDS 210..632 /gene="LOC101021384" /codon_start=1 /product="divergent paired-related homeobox-like" /protein_id="XP_021788647.1" /db_xref="GeneID:101021384" /translation="MFTEKLLEDLNSFFNENLYPNPSLQWASKIEIHPTVLEVWFENHRAKLKKAKCEHVQQKQETQQPSIPEGEVKTSAGLRNTDTLLRFPNAAHPIGLVYMNLRAPSFLLILYPNLKVPTNDFPGQKIVHFGCCQNPNIYCL" misc_feature 213..356 /gene="LOC101021384" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature <237..503 /gene="LOC101021384" /note="Homeobox protein; Region: Abdominal-A; cl27820" /db...
XM_021932955.1 - Papio anubis (olive baboon) - NCBI
Ixodes scapularis homeobox protein Pknox1, putative, mRNA. (912 bp)
start=1 /product="homeobox protein Pknox1, putative" /protein_id="XP_002411483.1" /db_xref="VectorBase:ISCW011271-PA" /db_xref="GeneID:8035653" /db_xref="VectorBase:ISCW011271" /translation="ALCRHPLFPLLALLFEKCERATQSAEAPCSESFSSDIQAFVQHQEQDRKPFFSDDPEVDGLMVKAIQVLRIHLLELEKVQELCKDFCNRYIACLKNKMQSENLLRSADFPSSGAGGCDGGLSDSPSSSACSSPAPAPSPPPPHHPLVAPQVSGKESSSGDGRFCYLMPVLAWLFQSTCLSASTLSPGQVVSGGTVFQVCPIVLRCWLSSSSATQQHPYPTEDEKRQIAAQTNLTLLQVNNWFINARRRILQPMLDASNPESSQKAKKAKVQTVRPVERFWPDAIASLQPRASGHNGTGSAPSPG" misc_feature 70..324 /locus_tag="IscW_ISCW011271" /note="N-terminal of Homeobox Meis and PKNOX1; Region...
XM_002411438.1 - Ixodes scapularis (black-legged tick) - NCBI
Entamoeba invadens IP1 homeobox protein knotted-1, putative (EIN_475530) mRNA, complete cds. (858 bp)
LOCUS XM_004255584 858 bp mRNA linear INV 26-MAR-2013 DEFINITION Entamoeba invadens IP1 homeobox protein knotted-1, putative (EIN_475530) mRNA, complete cds. ACCESSION XM_004255584 VERSION XM_004255584.1 KEYWORDS RefSeq. SOURCE Entamoeba invadens IP1 ORGANISM Entamoeba invadens IP1 Eukaryota;...containing transcription factor [Transcription]; Region: COG5576" /db_xref="CDD:227863" misc_feature 709..828 /locus_tag="EIN_475530" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:283551" ORIGIN // REFERENCE 1 (bases 1 to 858) AUTHORS Zafar,N., Inman,J., Hall,N., Lorenzi,H...
XM_004255584.1 - Entamoeba invadens IP1 - NCBI
Ixodes scapularis nk homeobox protein, putative, mRNA. (360 bp)
by transcript IscW_ISCW002094-RA; Gene spans sequencing gaps and may be missing exons." /codon_start=1 /product="nk homeobox protein, putative" /protein_id="XP_002408990.1" /db_xref="VectorBase:ISCW002094-PA" /db_xref="GeneID:8027604" /db_xref="VectorBase:ISCW002094" /translation="MFGKLWELETSATSPTSAATGTASTPGPGRGRLSVSPVNGASGDCADKAARKKKARTTFTGRQIFELEKQFEIKKYLSSSERAEMAKLLNVTETQGCRGITFGVVKLNTKNSANEGSPH" misc_feature 169..>285 /locus_tag="IscW_ISCW002094" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 360) AUTHORS Nene,V. CONSRTM Ixodes...
XM_002408946.1 - Ixodes scapularis (black-legged tick) - NCBI
Canis lupus familiaris PROP paired-like homeobox 1 (PROP1), mRNA. (681 bp)
product="homeobox protein prophet of Pit-1" /protein_id="NP_001018643.1" /db_xref="GeneID:474647" /translation="MEAEGRSERGKQKKGRLCGSLWPDSYPAAGTLTSTVDVSPQPSKNLSGVGVRRPRLSPQGGQRGRLHSRRRHRTTFNPGQLEQLETAFGRNQYPDIWAREGLARDTGLSEARIQVWFQNRRAKQRKQERSLLQPLAHLSPATFSGFLPESPACPYSYPTPPPPMTCFPHPYNHALPSQPSTGGSFARPHQSEDWYPTLHPPPTGHLPCPPPPTMLPLSLEPPKSWN" misc_feature order(208..222,226..228,277..279,295..297,334..336, 340..345,352..357,361..369,373..378) /gene="PROP1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 214..375 /gene="PROP1" /note="Homeobox domain; Region: Homeobox...
NM_001020807.1 - Canis lupus familiaris (dog) - NCBI
Ixodes scapularis nk-6 homeobox protein, putative, mRNA. (390 bp)
transcript IscW_ISCW014430-RA; Gene spans sequencing gaps and may be missing exons." /codon_start=1 /product="nk-6 homeobox protein, putative" /protein_id="XP_002416171.1" /db_xref="VectorBase:ISCW014430-PA" /db_xref="GeneID:8043228" /db_xref="VectorBase:ISCW014430" /translation="MASADSRPNIEQPPHSQCVAGDPLGKQLRPGSSPHSGVAQNCLDKDGKKKHTRPTFSGHQIYVLEKTFEQTKYLAGPERAKLAYALGMSERIQSGPLRRETPRPQAGHADVGSCIVAGGKPTLFRHVVT" misc_feature 154..>273 /locus_tag="IscW_ISCW014430" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 390) AUTHORS Nene,V....
XM_002416126.1 - Ixodes scapularis (black-legged tick) - NCBI
Danio rerio brain-specific homeobox (bsx), mRNA. (848 bp)
LOCUS NM_214727 848 bp mRNA linear VRT 03-SEP-2017 DEFINITION Danio rerio brain-specific homeobox (bsx), mRNA. ACCESSION NM_214727 XM_687721 VERSION NM_214727.1 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;...gene="bsx" /note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 409..567 /gene="bsx" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 848) AUTHORS Kok FO, Taibi A, Wanner SJ, Xie X, Moravec...
NM_214727.1 - Danio rerio (zebrafish) - NCBI - UCSC
Glycine max homeobox associated leucine zipper-containing protein (LOC100499926), mRNA. (1696 bp)
LOCUS NM_001251164 1696 bp mRNA linear PLN 17-AUG-2017 DEFINITION Glycine max homeobox associated leucine zipper-containing protein (LOC100499926), mRNA. ACCESSION NM_001251164 XM_006577715 VERSION NM_001251164.2 KEYWORDS RefSeq. SOURCE Glycine max (soybean) ORGANISM Glycine max Eukaryota;...gene="LOC100499926" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 481..633 /gene="LOC100499926" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:306543" misc_feature order(481..483,601..603,610..615,622..624) /gene="LOC100499926" /note="specific...
NM_001251164.2 - Glycine max (soybean) - NCBI
Glycine max homeodomain/HOMEOBOX transcription factor (LOC100797862), mRNA. (1005 bp)
Location/Qualifiers source 1..1005 /organism="Glycine max" /mol_type="mRNA" /cultivar="Williams 82" /db_xref="taxon:3847" /chromosome="7" /map="7" gene 1..1005 /gene="LOC100797862" /note="homeodomain/HOMEOBOX transcription factor" /db_xref="GeneID:100797862" misc_feature 153..155 /gene="LOC100797862" /note="upstream in-frame stop codon" CDS 168..884 /gene="LOC100797862" /note="homeobox-leucine zipper protein ATHB-12-like" /codon_start=1 /product="homeodomain/HOMEOBOX transcription factor" /protein_id="NP_001341790.1" /db_xref="GeneID:100797862" /translation="...
NM_001354861.1 - Glycine max (soybean) - NCBI
Xenopus laevis HESX homeobox 1 L homeolog (hesx1.L), mRNA. (848 bp)
laevis" /mol_type="mRNA" /db_xref="taxon:8355" gene 1..848 /gene="hesx1.L" /gene_synonym="anf1; anf2; hesx1; hesx1-a; hesx1-b; rpx; Xanf; xanf-1; XANF-2; Xanf2" /note="HESX homeobox 1 L homeolog" /db_xref="GeneID:397950" /db_xref="Xenbase:XB-GENE-864952" CDS 35..598 /gene="hesx1.L" /gene_synonym="anf1; anf2; hesx1; hesx1-a; hesx1-b; rpx; Xanf; xanf-1; XANF-2; Xanf2" /note="homeobox expressed in ES cells 1; Homeobox protein ANF-1; xanf1; homeo box-containing protein" /codon_start=1 /product="homeobox expressed in ES cells 1-B" /protein_id="NP_001156042.1" /db_xref="GeneID:397950" /db_xref="...
Synonym: anf1; anf2; hesx1; hesx1-a; hesx1-b; rpx; Xanf; xanf-1; XANF-2; Xanf2
NM_001162570.1 - Xenopus laevis (African clawed frog) - NCBI
Canis lupus familiaris pancreatic and duodenal homeobox 1 (PDX1), mRNA. (1496 bp)
LOCUS NM_001284471 1496 bp mRNA linear MAM 11-SEP-2017 DEFINITION Canis lupus familiaris pancreatic and duodenal homeobox 1 (PDX1), mRNA. ACCESSION NM_001284471 XM_543155 VERSION NM_001284471.2 KEYWORDS RefSeq. SOURCE Canis lupus familiaris (dog) ORGANISM Canis lupus familiaris Eukaryota; Metazoa;...PDX-1" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 540..701 /gene="PDX1" /gene_synonym="IPF1; PDX-1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(540..542,549..551,669..671,678..683,690..692) /gene="PDX1" /gene_...
Synonym: IPF1; PDX-1
NM_001284471.2 - Canis lupus familiaris (dog) - NCBI
Ixodes scapularis homeobox protein arx, putative, mRNA. (621 bp)
note="encoded by transcript IscW_ISCW017713-RA" /codon_start=1 /product="homeobox protein arx, putative" /protein_id="XP_002404118.1" /db_xref="VectorBase:ISCW017713-PA" /db_xref="GeneID:8029252" /db_xref="VectorBase:ISCW017713" /translation="MRAPRGTHLTVVVGSPTQSSSPLDYRCHASPTRPTTSPREAMGLSDRGDPPCANEGPQLPSVQTNPRTATPASSDALCHRITSTSLTGGGRFDLVATADDGDRSSARRPTPPTPVANAVANHHHHHQQNQHQSSHQSHQGQHHQQQNHTSSSGRASMLMRPDSPQEMTDDFPKRKQRRYRTTFTSYQLEELEKAFSRTHYPDVFTR" misc_feature 538..>618 /locus_tag="IscW_ISCW017713" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE...
XM_002404074.1 - Ixodes scapularis (black-legged tick) - NCBI
Salmo salar homeobox protein HoxC5ba (hoxc5ba), mRNA. (806 bp)
LOCUS NM_001141621 806 bp mRNA linear VRT 17-APR-2013 DEFINITION Salmo salar homeobox protein HoxC5ba (hoxc5ba), mRNA. ACCESSION NM_001141621 VERSION NM_001141621.1 KEYWORDS RefSeq. SOURCE Salmo salar (Atlantic salmon) ORGANISM Salmo salar Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...gene="hoxc5ba" /note="DNA binding site [nucleotide binding]" /db_xref="CDD:238039" misc_feature 553..714 /gene="hoxc5ba" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(553..555,562..564,682..684,691..696,703..705) /gene="hoxc5ba" /note="specific DNA...
NM_001141621.1 - Salmo salar (Atlantic salmon) - NCBI
Ixodes scapularis nk homeobox protein, putative, mRNA. (228 bp)
VectorBase:ISCW024267" CDS <1..228 /locus_tag="IscW_ISCW024267" /note="encoded by transcript IscW_ISCW024267-RA" /codon_start=1 /product="nk homeobox protein, putative" /protein_id="XP_002433688.1" /db_xref="VectorBase:ISCW024267-PA" /db_xref="GeneID:8050402" /db_xref="VectorBase:ISCW024267" /translation="VRKPKAAPDNSPHKNHRGTSKKPRRRRTAFTQSQLAFLENKFRYQKYLSVSDRGSVAEALHLTETQVKTWYQNRR" misc_feature 76..225 /locus_tag="IscW_ISCW024267" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" misc_feature order(76..78,85..87,205..207,214..219) /locus_tag="IscW_ISCW024267" /note="...
XM_002433643.1 - Ixodes scapularis (black-legged tick) - NCBI
Xenopus laevis distal-less homeobox 2 L homeolog (dlx2.L), mRNA. (1086 bp)
XDLL-4" /codon_start=1 /product="homeobox protein DLL-4" /protein_id="NP_001084032.1" /db_xref="GeneID:399264" /db_xref="Xenbase:XB-GENE-852896" /translation="MTGVFDSLAADMHSNHMPSSSYHSLHKSQESPTLPVSTATDSSYYTNHCGAVSPYGQLGSYQFHGAAINGISYSTKSYDLSYTGSYSSYGPYGTSPSPPHNDQEKEDCEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGVTQTQVKIWFQNRRSKFKKMWKSGEIPSDQLPVGSESSPCSSPSASTATWDFGPHQRLQGATNGSALQSSNSASSPSPFLSNYSWYQTSNSAPHLQSNPLLQQHHLHHHPPAPISAGTIF" misc_feature 310..546 /gene="dlx2.L" /gene_synonym="dll4; dlx2; tes-1; tes1; X-dll2; X-dll4; Xdll4" /note="Homeobox protein distal-less-like N terminal; Region...
Synonym: dll4; dlx2; tes-1; tes1; X-dll2; X-dll4; Xdll4
NM_001090563.2 - Xenopus laevis (African clawed frog) - NCBI
Ixodes scapularis Iroquois-class homeobox protein IRX, putative, mRNA. (200 bp)
note="encoded by transcript IscW_ISCW012614-RA; Gene spans sequencing gaps and may be missing exons." /codon_start=3 /product="Iroquois-class homeobox protein IRX, putative" /protein_id="XP_002413093.1" /db_xref="VectorBase:ISCW012614-PA" /db_xref="GeneID:8039004" /db_xref="VectorBase:ISCW012614" /translation="KRHERTTNTLKAWLYEHRKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPRNK" misc_feature 39..158 /locus_tag="IscW_ISCW012614" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:283551" STS 44..108 /locus_tag="IscW_ISCW012614" /standard_name="Irx3" /db_xref="UniSTS:498475"...
XM_002413048.1 - Ixodes scapularis (black-legged tick) - NCBI
Oryzias latipes GS homeobox 1 (gsx1), mRNA. (1344 bp)
LOCUS NM_001104833 1344 bp mRNA linear VRT 07-AUG-2017 DEFINITION Oryzias latipes GS homeobox 1 (gsx1), mRNA. ACCESSION NM_001104833 VERSION NM_001104833.1 KEYWORDS RefSeq. SOURCE Oryzias latipes (Japanese medaka) ORGANISM Oryzias latipes Eukaryota; Metazoa; Chordata; Craniata; Vertebrata;...DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 489..647 /gene="gsx1" /gene_synonym="gsh-1; Gsh1" /note="Homeobox domain; Region: Homeobox; pfam00046" /db_xref="CDD:278475" ORIGIN // REFERENCE 1 (bases 1 to 1344) AUTHORS Pasquier J, Cabau C, Nguyen T, Jouanno E...
Synonym: gsh-1; Gsh1
NM_001104833.1 - Oryzias latipes (Japanese medaka) - NCBI
Aspergillus flavus NRRL3357 homeobox and C2H2 transcription factor, putative, mRNA. (1845 bp)
LOCUS XM_002373225 1845 bp mRNA linear PLN 19-JAN-2010 DEFINITION Aspergillus flavus NRRL3357 homeobox and C2H2 transcription factor, putative, mRNA. ACCESSION XM_002373225 VERSION XM_002373225.1 KEYWORDS RefSeq. SOURCE Aspergillus flavus NRRL3357 ORGANISM Aspergillus flavus NRRL3357 Eukaryota;...misc_feature 915 /locus_tag="AFLA_083510" /note="Homeobox protein; Region: Abdominal-A; cl27820" /db_xref="CDD:332641" misc_feature 766..885 /locus_tag="AFLA_083510" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:310480" ORIGIN // REFERENCE 1 (bases 1 to 1845) AUTHORS...
XM_002373225.1 - Aspergillus flavus NRRL3357 - NCBI
Entamoeba dispar SAW760 homeobox protein knotted-1, putative EDI_194210 mRNA, complete cds. (720 bp)
LOCUS XM_001735248 720 bp mRNA linear INV 01-NOV-2008 DEFINITION Entamoeba dispar SAW760 homeobox protein knotted-1, putative EDI_194210 mRNA, complete cds. ACCESSION XM_001735248 VERSION XM_001735248.1 KEYWORDS RefSeq. SOURCE Entamoeba dispar SAW760 ORGANISM Entamoeba dispar SAW760 Eukaryota;...note="specific DNA base contacts [nucleotide binding]; other site" /db_xref="CDD:238039" misc_feature 556..675 /locus_tag="EDI_194210" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:283551" ORIGIN // REFERENCE 1 (bases 1 to 720) AUTHORS Lorenzi,H., Inman,J., Schobel,S.,...
XM_001735248.1 - Entamoeba dispar SAW760 - NCBI
Oryzias latipes distal-less homeobox 2 (dlx2), mRNA. (1648 bp)
note="distal-less homeobox 2" /db_xref="GeneID:100049449" CDS 158..991 /gene="dlx2" /gene_synonym="dlx2a" /codon_start=1 /product="homeobox protein DLX-2" /protein_id="NP_001098290.1" /db_xref="GeneID:100049449" /translation="MTGVFENLNTDMHSNQITSNSYHSLHKSQESPTLPVSTATDSSYYNGPQPGHCTGTPFGQLGSYQYHSNATGSVPYNAKTYELGFNSSYGAYSSYGSTNSPTPPADNEKEESEPEIRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNRRSKFKKQWKSGEIPPEQHVAASESPPCTSPPTTAWDFPQTQRMNSISSSLPQSISPPNTTAPSSFLTNYSWYSTTNSTTHLQSPLVQHHHGSAISAGTIF" misc_feature 242..469 /gene="dlx2" /gene_synonym="dlx2a" /note="Homeobox protein distal-less-...
Synonym: dlx2a
NM_001104820.1 - Oryzias latipes (Japanese medaka) - NCBI

Data Export:

下記より最大10000件まで検索結果を取得できます。

Debug Info:

Redirect URI : http://ggrna.dbcls.jp/ja/homeobox
lang : ja | div : | spe : | query_string : homeobox | format : html | download :

0.000 | 0.000 | search_start;
0.389 | 0.389 | count_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=0&format=json
0.749 | 0.360 | search_done; http://172.18.8.71:7700/v1/refsub/query?q=((full_search:*:homeobox)%7C(nt:homeobox)%7C(aa:homeobox))?to=49?from=0?snippet=full_search?drilldown=source?get=accession,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.755 | 0.006 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]