LOCUS       NM_204804               1151 bp    mRNA    linear   VRT 19-SEP-2023
DEFINITION  Gallus gallus distal-less homeobox 3 (DLX3), mRNA.
ACCESSION   NM_204804 XM_015299469
VERSION     NM_204804.2
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 1151)
  AUTHORS   Tang H, Finn RD and Thomas PD.
  TITLE     TreeGrafter: phylogenetic tree-based annotation of proteins with
            Gene Ontology terms and other annotations
  JOURNAL   Bioinformatics 35 (3), 518-520 (2019)
   PUBMED   30032202
REFERENCE   2  (bases 1 to 1151)
  AUTHORS   Uribe RA, Buzzi AL, Bronner ME and Strobl-Mazzulla PH.
  TITLE     Histone demethylase KDM4B regulates otic vesicle invagination via
            epigenetic control of Dlx3 expression
  JOURNAL   J Cell Biol 211 (4), 815-827 (2015)
   PUBMED   26598618
  REMARK    GeneRIF: KDM4B plays a critical role during inner ear invagination
            via modulating histone methylation of the direct target Dlx3.
REFERENCE   3  (bases 1 to 1151)
  AUTHORS   Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C,
            Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S.
  TITLE     Manual GO annotation of predictive protein signatures: the InterPro
            approach to GO curation
  JOURNAL   Database (Oxford) 2012, bar068 (2012)
   PUBMED   22301074
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1151)
  AUTHORS   Zhu H and Bendall AJ.
  TITLE     Dlx3 is expressed in the ventral forebrain of chicken embryos:
            implications for the evolution of the Dlx gene family
  JOURNAL   Int J Dev Biol 50 (1), 71-75 (2006)
   PUBMED   16323080
  REMARK    GeneRIF: Dlx3 gene expression is described in the forebrain of
            chicken embryos; this constitutes the first documented evidence of
            expression of either Dlx3 or Dlx4 in the vertebrate central nervous
            system
REFERENCE   5  (bases 1 to 1151)
  AUTHORS   Brown ST, Wang J and Groves AK.
  TITLE     Dlx gene expression during chick inner ear development
  JOURNAL   J Comp Neurol 483 (1), 48-65 (2005)
   PUBMED   15672396
  REMARK    GeneRIF: Inner ear expression patterns of Dlx3, Dlx5, and Dlx6 were
            examined during the first 7 days of chicken embryonic development.
REFERENCE   6  (bases 1 to 1151)
  CONSRTM   International Chicken Genome Sequencing Consortium
  TITLE     Sequence and comparative analysis of the chicken genome provide
            unique perspectives on vertebrate evolution
  JOURNAL   Nature 432 (7018), 695-716 (2004)
   PUBMED   15592404
  REMARK    Erratum:[Nature. 2005 Feb 17;433(7027):777]
REFERENCE   7  (bases 1 to 1151)
  AUTHORS   Pera E and Kessel M.
  TITLE     Expression of DLX3 in chick embryos
  JOURNAL   Mech Dev 89 (1-2), 189-193 (1999)
   PUBMED   10559497
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            AADN05000735.1.
            
            On Mar 13, 2018 this sequence version replaced NM_204804.1.
            
            ##Evidence-Data-START##
            RNAseq introns :: single sample supports all introns
                              SAMEA103992484, SAMEA103992527 [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-399               AADN05000735.1     125381-125779
            400-590             AADN05000735.1     126566-126756
            591-1151            AADN05000735.1     128606-129166
FEATURES             Location/Qualifiers
     source          1..1151
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="27"
                     /map="27"
                     /breed="Red Jungle Fowl"
     gene            1..1151
                     /gene="DLX3"
                     /note="distal-less homeobox 3"
                     /db_xref="CGNC:49390"
                     /db_xref="GeneID:395590"
     exon            1..399
                     /gene="DLX3"
                     /inference="alignment:Splign:2.1.0"
     CDS             81..917
                     /gene="DLX3"
                     /note="DLX3 homeodomain containing protein"
                     /codon_start=1
                     /product="homeobox protein DLX-3"
                     /protein_id="NP_990135.2"
                     /db_xref="CGNC:49390"
                     /db_xref="GeneID:395590"
                     /translation="

MSGSFDKKLSSILTDLSGSLSCHASSKDSPTLPESSVTDLGYYSGQHDYYPGQSYGQPVAHYPYPQFNLNAIGAGGTYSPKSDYSYSPSYRQYGHFRDQQLPAQDAVSVKEEPEPEVRMVNGKPKKIRKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLEHSPNNSDSMACNSPPSPAVWDSATHGGAPGRTPLPQPLPYSPSPAFLEEHSPWYHPQSLAAPHQPPAAMHHTSPGPPPNPGAVY"

     misc_feature    159..395
                     /gene="DLX3"
                     /note="Homeobox protein distal-less-like N terminal;
                     Region: DLL_N; pfam12413"
                     /db_xref="CDD:463567"
     misc_feature    462..632
                     /gene="DLX3"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            400..590
                     /gene="DLX3"
                     /inference="alignment:Splign:2.1.0"
     exon            591..1151
                     /gene="DLX3"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

gcctctcagcgggagcgcatcggggtacgttgtgggcagcggggggtcccgggcgggcggcagccccccgagcggcagcgatgagcggctccttcgacaagaagctctccagcatcctcaccgacctgtcgggctcgctgagctgccatgcctcctccaaggactccccgacgctgcccgagtcctccgtcaccgacctgggctattacagcggccagcacgactactacccgggccagtcctacgggcagcccgtcgcccactacccctacccccaattcaacctcaacgccatcggtgccggcggaacctattcccccaaatccgactattcctacagcccgtcctaccgtcagtacggccacttcagggaccagcagctcccggcgcaggacgcagtgtcggtgaaggaagagccggagcccgaggtgcggatggtcaacgggaaacccaagaagatccgcaaaccccgcaccatctactccagttaccaactggccgccctgcagcgccgcttccagaaagcccaatacctggcgctgcccgaacgcgccgagctggcggcacagctggggctcacccagacccaggtgaagatctggttccagaaccgccgctccaagttcaagaagctctacaagaacggcgaggtgccgttggagcacagccccaacaacagcgattccatggcctgcaactccccaccgtcgcccgccgtttgggacagtgccactcacggcggcgcgccgggacggacccccctcccgcagccactgccctacagcccctcgcccgccttcctggaggagcacagcccctggtaccacccgcagagcctcgccgccccccaccagccgcccgccgccatgcaccacacctcgccggggccgccccccaacccgggcgccgtttactaaccgtgggggcagagacagtgcggaactccttctctcttccctttctcccccctcagcccccccccatccccgccccctcagccccccaatgatgattattttttaaagtgttccaggacacgcgcccctatgtacccacctctatatcctctcctctcccagctcatctcaggaacaacgggactgcaaagggttgaactcgtgagctctgcgcccaggggacaccaccgctgc

//