LOCUS       NM_001199548            1704 bp    mRNA    linear   VRT 24-SEP-2023
DEFINITION  Gallus gallus NK6 homeobox 2 (NKX6-2), mRNA.
ACCESSION   NM_001199548 XM_421832
VERSION     NM_001199548.2
KEYWORDS    RefSeq.
SOURCE      Gallus gallus (chicken)
  ORGANISM  Gallus gallus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes;
            Phasianidae; Phasianinae; Gallus.
REFERENCE   1  (bases 1 to 1704)
  AUTHORS   Tang H, Finn RD and Thomas PD.
  TITLE     TreeGrafter: phylogenetic tree-based annotation of proteins with
            Gene Ontology terms and other annotations
  JOURNAL   Bioinformatics 35 (3), 518-520 (2019)
   PUBMED   30032202
REFERENCE   2  (bases 1 to 1704)
  AUTHORS   Burge S, Kelly E, Lonsdale D, Mutowo-Muellenet P, McAnulla C,
            Mitchell A, Sangrador-Vegas A, Yong SY, Mulder N and Hunter S.
  TITLE     Manual GO annotation of predictive protein signatures: the InterPro
            approach to GO curation
  JOURNAL   Database (Oxford) 2012, bar068 (2012)
   PUBMED   22301074
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1704)
  AUTHORS   Cai J, St Amand T, Yin H, Guo H, Li G, Zhang Y, Chen Y and Qiu M.
  TITLE     Expression and regulation of the chicken Nkx-6.2 homeobox gene
            suggest its possible involvement in the ventral neural patterning
            and cell fate specification
  JOURNAL   Dev Dyn 216 (4-5), 459-468 (1999)
   PUBMED   15672537
  REMARK    GeneRIF: these studies have suggested two different roles for the
            cNkx-6.2 transcription factor: participating in the Shh-initiated
            ventral patterning during early CNS development and controlling
            cell fate specification and differentiation during late
            development.
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            JAENSK010000233.1.
            
            On Nov 24, 2021 this sequence version replaced NM_001199548.1.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            ##Evidence-Data-START##
            Transcript exon combination :: SRR13267650.37470.1, HAEK01097412.1
                                           [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA103992290, SAMEA103992323
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-760               JAENSK010000233.1  312436-313195       c
            761-933             JAENSK010000233.1  312006-312178       c
            934-1704            JAENSK010000233.1  310736-311506       c
FEATURES             Location/Qualifiers
     source          1..1704
                     /organism="Gallus gallus"
                     /mol_type="mRNA"
                     /db_xref="taxon:9031"
                     /chromosome="6"
                     /map="6"
     gene            1..1704
                     /gene="NKX6-2"
                     /gene_synonym="NKX-6.2"
                     /note="NK6 homeobox 2"
                     /db_xref="CGNC:7982"
                     /db_xref="GeneID:395591"
     exon            1..760
                     /gene="NKX6-2"
                     /gene_synonym="NKX-6.2"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    337..339
                     /gene="NKX6-2"
                     /gene_synonym="NKX-6.2"
                     /note="upstream in-frame stop codon"
     CDS             346..1182
                     /gene="NKX6-2"
                     /gene_synonym="NKX-6.2"
                     /note="NK6 transcription factor related, locus 2"
                     /codon_start=1
                     /product="homeobox protein Nkx-6.2"
                     /protein_id="NP_001186477.1"
                     /db_xref="CGNC:7982"
                     /db_xref="GeneID:395591"
                     /translation="

MLAVGQMDANRQSAFVLGSTPLAALHNMAEMKSSLFPYALQNPSSFKAPALGGLNTQLPLGTPHGISDILGRPVGAAGNLLGGLPRINGLAASAGVYFGPAAVSRYPKPLAELPGRPPIFWPGVVQGSPWRDPRLTCPAQTGMVLDKDGKKKHSRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKRHAAEMASAKKKHDSETEKLKESSDNEDDDEYNKPLDPNSDDEKITRLLKKHKSTNLALVSPCSTSSDTL"

     misc_feature    793..969
                     /gene="NKX6-2"
                     /gene_synonym="NKX-6.2"
                     /note="Region: Homeodomain; pfam00046"
                     /db_xref="CDD:459649"
     exon            761..933
                     /gene="NKX6-2"
                     /gene_synonym="NKX-6.2"
                     /inference="alignment:Splign:2.1.0"
     exon            934..1704
                     /gene="NKX6-2"
                     /gene_synonym="NKX-6.2"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

ggccccggacgcgcgggcgaaggcgcggagctgagtggtgcggcgcctactggagccctgcgcggcgtagggccgcaggcaaccgggacgtggcgcgctccgtgcaccgctctggtggtgccgcttctctcctcccgccgcgccgtcggagcgcgtctccgagaacggagcgggtggagcggtgccgtgccgagccgaggttcttccgctccgagcaaactttgccggcggctgctgcccgcgacccacgaacggagagagggctgcgccggcgctcctcgcgtggggccgtaccgcgagcttcgccccacttggagcaggaccggcgtccgtggatgaccgccaatgttagcggtggggcagatggatgctaaccggcagagtgcgttcgtgctgggcagcacgccgctggccgcgctgcacaacatggccgagatgaagagctctctcttcccctacgccctgcagaacccctccagcttcaaggcgccggccctgggcggcctcaacacgcagttgcccctggggacgccgcacggcatcagcgacatcctggggcggcccgtgggcgccgccggcaacctgctgggcgggctgccccgcatcaacggcctggccgcctcggccggcgtgtacttcggccccgccgccgtatcccggtacccgaagccgctggcggagctgccggggcggccgcctatcttctggccgggagtggtacagggctctccgtggcgggacccgcgcctcacctgtcccgctcagacggggatggttttggacaaggacgggaagaagaagcactcgcgcccgactttctcggggcagcagatttttgctttggagaaaaccttcgagcagacgaagtacctggcagggcccgagcgagcgcggcttgcctattcgctggggatgacagagagccaggtgaaggtgtggttccagaacagacggaccaaatggcggaagcggcacgcggctgagatggcctcggcgaagaagaagcacgactcggagacggagaagctgaaggagagctcggacaatgaggatgatgacgaatacaacaaacccctggaccccaactcagatgacgagaaaatcacgaggctattgaaaaagcacaaatccacgaacctcgccctcgtcagcccctgcagcaccagctcggacacgttgtgagcggtgcgcctggatgtcgaagtggtgtgttgtacagcccgagatgtatgtgaaatgtatatattttttacagaataagttatgaaattattttctttctcatcgatgtaaatttcggaggaatctttccgacttcttggttttcctttcatgtccctttcaggttcgctcctctctctttcagccaattcctgctcctaacaatcagcgtttgtcaccgttttgtatggagcacaaaaccccagcgcggccactttgtacatagtgaacttcagattttgtgatgtatatttctagtgtaaaaacagcgttttctttcactccttccctctgctcaggggtttggcggtttgatttcttctgcctccggattttatgcttaataatatcaaaagaggggaaaaaaaaacgcaagagaaaaaaaaggacacttgattttaaattggattaatactgtcgtctccacacgggttggaaagacttcgtatacatcaataaattatttaacacgctttgccttca

//