2024-11-01 12:41:28, GGRNA.v2 : RefSeq release 226 (Sep, 2024)
LOCUS XM_692189 1126 bp mRNA linear VRT 08-SEP-2024 DEFINITION PREDICTED: Danio rerio claudin 34a (cldn34a), mRNA. ACCESSION XM_692189 VERSION XM_692189.10 DBLINK BioProject: PRJNA13922 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_007117.7) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process On Sep 8, 2024 this sequence version replaced XM_692189.9. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_000002035.6-RS_2024_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/15/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1126 /organism="Danio rerio" /mol_type="mRNA" /strain="Tuebingen" /db_xref="taxon:7955" /chromosome="6" gene 1..1126 /gene="cldn34a" /note="claudin 34a; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 ESTs, 4 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments, including 134 samples with support for all annotated introns" /db_xref="GeneID:568833" /db_xref="ZFIN:ZDB-GENE-130819-3" misc_feature 1 /gene="cldn34a" /experiment="COORDINATES: cap analysis [ECO:0007248]" /note="transcription start site" CDS 166..891 /gene="cldn34a" /codon_start=1 /product="claudin-34" /protein_id="XP_697281.2" /db_xref="GeneID:568833" /db_xref="ZFIN:ZDB-GENE-130819-3" /translation="
MAYLAQSVHRQFAGLVLGFVAWIMTASVSGVNDWRIWYVDNTTVITGGVAWVGVWRACFNSHVLDSAEICKSIGLTDSFTPPEIAAAQVLCMIAIGVGVVANLLAGYAVRNAIFGVDGGHVRLAFVMAGSLYWLTATCSLVPVFWNMSSVLANLTIDFPPEFYLPSTPVKQEVGPGIGIGIGAGCLLIVSGLLLMCYRYPKTKMPLSEENGHFDKSQRNEGCFGVIKESVDEGIINTAFEA"
misc_feature 223..747 /gene="cldn34a" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN
gtgtcatatgaacgctgaaggtgaagggttctgtgttttggataaactgtgacaatttcaaagatgcttcatacatcaaacatgcttcacagaattggtgtgactgaactgcagccatgaccccaaaggacagctgccaatcctgaggagatttgtgtttcagaaatggcttacctggcgcaatctgtccaccggcagtttgcaggtctggtgttggggtttgtagcatggataatgacggcctctgtttctggcgtgaacgactggaggatttggtacgtagacaatacgacggtcatcaccggtggagtggcctgggtgggcgtttggagggcctgtttcaacagccacgttttggactctgcggagatctgcaaaagcatcggccttacagattccttcactcctccagagattgcagctgctcaggtgctttgcatgatcgctattggcgtaggggttgttgcgaacctgctggctggatatgcagtgagaaacgccatcttcggggtagacggtggccatgtcaggttggcgtttgtgatggcgggtagcttgtattggttgactgccacgtgttcgctggtccctgtcttttggaatatgagttcggttctggccaatctcactatagattttcctcctgaattttacttgccttccactcctgtaaaacaggaagtgggtcctgggatcggaattgggatcggtgcaggttgtctactcattgtaagtggactactgttaatgtgctacaggtatcctaaaaccaagatgcctttgagtgaagaaaatggacattttgacaaaagtcaaaggaatgaaggctgttttggtgtaattaaagagagtgtggatgaagggataatcaacactgcctttgaagcttagaagcgctatttaaatccataactgtatggaaagactttgaaagatctaaaatactcattttggactgtttgaggagaacttgtttatatctaaatagaatatactttatttaaattattttattataatttgaatatttcataatttagtgatatgaataaaggcaagctgtctgaattgtattgatatcagtcctattacaggtcgcatatcaacttttgtttctcttattttt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]