2024-11-01 12:26:48, GGRNA.v2 : RefSeq release 226 (Sep, 2024)
LOCUS XM_005161279 1121 bp mRNA linear VRT 08-SEP-2024 DEFINITION PREDICTED: Danio rerio claudin 28 (cldn28), mRNA. ACCESSION XM_005161279 VERSION XM_005161279.5 DBLINK BioProject: PRJNA13922 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_007132.7) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process On Sep 8, 2024 this sequence version replaced XM_005161279.4. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_000002035.6-RS_2024_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/15/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1121 /organism="Danio rerio" /mol_type="mRNA" /strain="Tuebingen" /db_xref="taxon:7955" /chromosome="21" gene 1..1121 /gene="cldn28" /note="claudin 28; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 ESTs, 100 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:796314" /db_xref="ZFIN:ZDB-GENE-201223-1" misc_feature 1 /gene="cldn28" /experiment="COORDINATES: cap analysis [ECO:0007248]" /note="transcription start site" CDS 93..662 /gene="cldn28" /codon_start=1 /product="claudin-like protein ZF-A89" /protein_id="XP_005161336.1" /db_xref="GeneID:796314" /db_xref="ZFIN:ZDB-GENE-201223-1" /translation="
MRTRQFVAAFLALVGLCGTILICALPMWKVSAFVGANIVTAQVYWQGLWMNCVLQSTGHMQCMAYYSVLALTQDLQAARGLICASIGVSAIAFGMMVVGANCTRFYREDQLKKTNIGISAGALYIVGGVMCLVAVCWQTSIIVMNFYNPQVIAGTQGELGACIYIGWVAGFLLIIGGGLLLSTYSNRCC"
misc_feature 105..599 /gene="cldn28" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN
agagaattcacattgtaaatagtctttcacttgcacaactaccacattttccttcctttcattgcagatggtttgtcttcgctctatgaaaaatgaggacacgacagttcgtggctgcatttctggctttggttggcctgtgcgggaccatcctgatttgtgccttgcctatgtggaaagtgtcggcctttgtcggagcgaacattgtgactgcacaggtctactggcaaggcttgtggatgaactgcgtcttgcaaagcactggccacatgcagtgcatggcgtattactctgttctggcactgactcaagatctccaggccgctcgtggtttgatttgtgcttctatcggtgtcagtgcaattgcctttggaatgatggttgttggggccaattgtacacggttttacagagaagatcaacttaaaaagaccaacattggaatatcagctggcgcattgtatatagttggaggtgtaatgtgccttgttgctgtctgctggcagacgtctattattgtcatgaacttttataatcctcaagtaatagcagggacacaaggagagctgggagcctgcatctatataggatgggtcgctggatttttgctaattattggcggtggactgcttttaagcacatactccaaccgatgttgttgaccagatttggggttaataagactcaactgactcagtttgacgccggattgtttctatttttccttggaggataaaatgtttttttctggatcccccaattcttcagagctgtttttaagactgtcaaatgtttgtttgtaatactgtgtatcagtacttactcaggcccgtagccagcctactaaaagtaaatctttttacagttattcaaggtttaaatactgtatttttaaacacattttaagcactaatttgtgctggattagcttgttgggtggttatcattaccacatttttcattaccacattttttgatccaacaaaaatacttcctacatttttatcaaagtgcttataatactatttttttgtttacaaaaatgtatgtttattcacaagttgtaacagttttatatgtaatgtattgagattagaatttttagaaatattgaaaaatac
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]