LOCUS       NM_180965               1070 bp    mRNA    linear   VRT 21-MAR-2021
DEFINITION  Danio rerio claudin g (cldng), mRNA.
ACCESSION   NM_180965 NM_001040392
VERSION     NM_180965.5
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 1070)
  AUTHORS   Solis CJ, Hamilton MK, Caruffo M, Garcia-Lopez JP, Navarrete P,
            Guillemin K and Feijoo CG.
  TITLE     Intestinal Inflammation Induced by Soybean Meal Ingestion Increases
            Intestinal Permeability and Neutrophil Turnover Independently of
            Microbiota in Zebrafish
  JOURNAL   Front Immunol 11, 1330 (2020)
   PUBMED   32793187
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 1070)
  AUTHORS   Winata CL, Lapinski M, Pryszcz L, Vaz C, Bin Ismail MH, Nama S,
            Hajan HS, Lee SGP, Korzh V, Sampath P, Tanavde V and Mathavan S.
  TITLE     Cytoplasmic polyadenylation-mediated translational control of
            maternal mRNAs directs maternal-to-zygotic transition
  JOURNAL   Development 145 (1) (2018)
   PUBMED   29229769
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 1070)
  AUTHORS   Shu Y, Lou Q, Dai Z, Dai X, He J, Hu W and Yin Z.
  TITLE     The basal function of teleost prolactin as a key regulator on ion
            uptake identified with zebrafish knockout models
  JOURNAL   Sci Rep 6, 18597 (2016)
   PUBMED   26726070
  REMARK    Publication Status: Online-Only
REFERENCE   4  (bases 1 to 1070)
  AUTHORS   Elkon R, Milon B, Morrison L, Shah M, Vijayakumar S, Racherla M,
            Leitch CC, Silipino L, Hadi S, Weiss-Gayet M, Barras E, Schmid CD,
            Ait-Lounis A, Barnes A, Song Y, Eisenman DJ, Eliyahu E, Frolenkov
            GI, Strome SE, Durand B, Zaghloul NA, Jones SM, Reith W and
            Hertzano R.
  TITLE     RFX transcription factors are essential for hearing in mice
  JOURNAL   Nat Commun 6, 8549 (2015)
   PUBMED   26469318
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 1070)
  AUTHORS   Zhang P, He Q, Chen D, Liu W, Wang L, Zhang C, Ma D, Li W, Liu B
            and Liu F.
  TITLE     G protein-coupled receptor 183 facilitates
            endothelial-to-hematopoietic transition via Notch1 inhibition
  JOURNAL   Cell Res 25 (10), 1093-1107 (2015)
   PUBMED   26358189
REFERENCE   6  (bases 1 to 1070)
  AUTHORS   Kolmakov NN, Kube M, Reinhardt R and Canario AV.
  TITLE     Analysis of the goldfish Carassius auratus olfactory epithelium
            transcriptome reveals the presence of numerous non-olfactory GPCR
            and putative receptors for progestin pheromones
  JOURNAL   BMC Genomics 9, 429 (2008)
   PUBMED   18803863
  REMARK    Publication Status: Online-Only
REFERENCE   7  (bases 1 to 1070)
  AUTHORS   Sumanas S, Jorniak T and Lin S.
  TITLE     Identification of novel vascular endothelial-specific genes by the
            microarray analysis of the zebrafish cloche mutants
  JOURNAL   Blood 106 (2), 534-541 (2005)
   PUBMED   15802528
REFERENCE   8  (bases 1 to 1070)
  AUTHORS   Qian F, Zhen F, Ong C, Jin SW, Meng Soo H, Stainier DY, Lin S, Peng
            J and Wen Z.
  TITLE     Microarray analysis of zebrafish cloche mutant using amplified cDNA
            and identification of potential downstream target genes
  JOURNAL   Dev Dyn 233 (3), 1163-1172 (2005)
   PUBMED   15937927
REFERENCE   9  (bases 1 to 1070)
  AUTHORS   Loh YH, Christoffels A, Brenner S, Hunziker W and Venkatesh B.
  TITLE     Extensive expansion of the claudin gene family in the teleost fish,
            Fugu rubripes
  JOURNAL   Genome Res 14 (7), 1248-1257 (2004)
   PUBMED   15197168
REFERENCE   10 (bases 1 to 1070)
  AUTHORS   Li Y, Chia JM, Bartfai R, Christoffels A, Yue GH, Ding K, Ho MY,
            Hill JA, Stupka E and Orban L.
  TITLE     Comparative analysis of the testis and ovary transcriptomes in
            zebrafish by combining experimental and computational tools
  JOURNAL   Comp Funct Genomics 5 (5), 403-418 (2004)
   PUBMED   18629171
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from
            CR762462.19.
            
            On Oct 4, 2018 this sequence version replaced NM_180965.4.
            
            Sequence Note: The RefSeq transcript and protein were derived from
            genomic sequence to make the sequence consistent with the reference
            genome assembly. The genomic coordinates used for the transcript
            record were based on alignments.
            
            Publication Note:  This RefSeq record includes a subset of the
            publications that are available for this gene. Please see the Gene
            record to access additional publications.
            
            ##Evidence-Data-START##
            Transcript exon combination :: CK872161.1, EH517838.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA2168446, SAMEA2168448
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-145               CR762462.19        65372-65516
            146-1070            CR762462.19        66568-67492
FEATURES             Location/Qualifiers
     source          1..1070
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /strain="Tuebingen"
                     /db_xref="taxon:7955"
                     /chromosome="1"
                     /map="1"
     gene            1..1070
                     /gene="cldng"
                     /gene_synonym="cb214; cldn5l; zgc:136312; zgc:152655"
                     /note="claudin g"
                     /db_xref="GeneID:81586"
                     /db_xref="ZFIN:ZDB-GENE-010328-7"
     exon            1..145
                     /gene="cldng"
                     /gene_synonym="cb214; cldn5l; zgc:136312; zgc:152655"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    136..138
                     /gene="cldng"
                     /gene_synonym="cb214; cldn5l; zgc:136312; zgc:152655"
                     /note="upstream in-frame stop codon"
     exon            146..1070
                     /gene="cldng"
                     /gene_synonym="cb214; cldn5l; zgc:136312; zgc:152655"
                     /inference="alignment:Splign:2.1.0"
     CDS             148..777
                     /gene="cldng"
                     /gene_synonym="cb214; cldn5l; zgc:136312; zgc:152655"
                     /codon_start=1
                     /product="claudin-like protein ZF-A9"
                     /protein_id="NP_851296.1"
                     /db_xref="GeneID:81586"
                     /db_xref="ZFIN:ZDB-GENE-010328-7"
                     /translation="

MSTGLQLLGTTLGTLGWLGIIISCAIPLWRVTAFIGNNIVTAQTMWEGLWMSCVVQSTGQMQCKVYDSMLALAQDLQASRAILVISAIVGLIAMFASFAGGKCTNCLADNSAKALVATTGGVAFIIAGILGLVPPSWTANTIIRDFYNPLVAEAQKREFGAAIFICWGAAVLLVIGGGLLCSSYPKGRTSSRGRYTPASQNGRERSEYV"

     misc_feature    <274..687
                     /gene="cldng"
                     /gene_synonym="cb214; cldn5l; zgc:136312; zgc:152655"
                     /note="PMP-22/EMP/MP20/Claudin family; Region:
                     PMP22_Claudin; cl21598"
                     /db_xref="CDD:473919"
ORIGIN      

agggatcgcacgagagtgtttgtcagtatggctacttcctaaaggagttgatttcttgcacgtaattttgttttaatgtgtcttggtttttagtgctttgtttactgtgagagaaatcagttgcaagctcatctgtaggtcacagacatgtctactggcttgcagctccttggaacaacactaggcactcttggctggctgggcataattatatcatgtgcaatccctctatggcgtgtgactgccttcattggaaacaacattgtgactgcacagacgatgtgggaagggctgtggatgagctgtgtggtgcagagtacaggccaaatgcagtgtaaagtgtatgactccatgctggctcttgcccaagatctgcaggcctctcgagctatccttgtcatttctgctattgttggtttaattgccatgtttgcaagttttgctggtggtaaatgtactaattgcctggcggataactccgcaaaggctctggttgctacaacaggaggcgttgccttcataattgcagggatcttgggtttggtgccacctagctggaccgctaatacaatcatcagagacttttacaatcctctcgtagctgaagcacagaagagggagtttggagcagccatcttcatctgctggggggcagcagtgctcctggttattggtggaggtctcctctgcagctcttacccaaaaggaagaacctccagcaggggtcggtatacaccagcttctcaaaatggaagagagcgctcggagtatgtgtgactgaaggatgtctgtttgaagaaattatagatttgttttaggtttttatctatttaaatgtctgtctgagatcgtctttgtaaagcagagatgaagtgatcaattgagctaataaaacacattttattcaacagagggcagtgtttcataactttaattttatacctgtttgaggatgtaccctttgcaaaccaaagaaggcaatctgctgaagtatgttgagctaattatgggatgttctaccagaaacctttttaacttaaaacaaataataataaaagaaagtgatatgg

//