2024-11-01 12:38:26, GGRNA.v2 : RefSeq release 226 (Sep, 2024)
LOCUS NM_131766 1796 bp mRNA linear VRT 16-OCT-2021 DEFINITION Danio rerio claudin f (cldnf), mRNA. ACCESSION NM_131766 VERSION NM_131766.2 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. REFERENCE 1 (bases 1 to 1796) AUTHORS Liu H, Leslie EJ, Jia Z, Smith T, Eshete M, Butali A, Dunnwald M, Murray J and Cornell RA. TITLE Irf6 directly regulates Klf17 in zebrafish periderm and Klf4 in murine oral epithelium, and dominant-negative KLF4 variants are present in patients with cleft lip and palate JOURNAL Hum Mol Genet 25 (4), 766-776 (2016) PUBMED 26692521 REFERENCE 2 (bases 1 to 1796) AUTHORS Shu Y, Lou Q, Dai Z, Dai X, He J, Hu W and Yin Z. TITLE The basal function of teleost prolactin as a key regulator on ion uptake identified with zebrafish knockout models JOURNAL Sci Rep 6, 18597 (2016) PUBMED 26726070 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 1796) AUTHORS Elkon R, Milon B, Morrison L, Shah M, Vijayakumar S, Racherla M, Leitch CC, Silipino L, Hadi S, Weiss-Gayet M, Barras E, Schmid CD, Ait-Lounis A, Barnes A, Song Y, Eisenman DJ, Eliyahu E, Frolenkov GI, Strome SE, Durand B, Zaghloul NA, Jones SM, Reith W and Hertzano R. TITLE RFX transcription factors are essential for hearing in mice JOURNAL Nat Commun 6, 8549 (2015) PUBMED 26469318 REMARK Publication Status: Online-Only REFERENCE 4 (bases 1 to 1796) AUTHORS Baltzegar DA, Reading BJ, Brune ES and Borski RJ. TITLE Phylogenetic revision of the claudin gene family JOURNAL Mar Genomics 11, 17-26 (2013) PUBMED 23726886 REFERENCE 5 (bases 1 to 1796) AUTHORS de la Garza G, Schleiffarth JR, Dunnwald M, Mankad A, Weirather JL, Bonde G, Butcher S, Mansour TA, Kousa YA, Fukazawa CF, Houston DW, Manak JR, Schutte BC, Wagner DS and Cornell RA. TITLE Interferon regulatory factor 6 promotes differentiation of the periderm by activating expression of Grainyhead-like 3 JOURNAL J Invest Dermatol 133 (1), 68-77 (2013) PUBMED 22931925 REMARK Erratum:[J Invest Dermatol. 2013 Mar;133(3):859] REFERENCE 6 (bases 1 to 1796) AUTHORS Kumai Y, Bahubeshi A, Steele S and Perry SF. TITLE Strategies for maintaining Na(+) balance in zebrafish (Danio rerio) during prolonged exposure to acidic water JOURNAL Comp Biochem Physiol A Mol Integr Physiol 160 (1), 52-62 (2011) PUBMED 21600298 REFERENCE 7 (bases 1 to 1796) AUTHORS Clelland ES and Kelly SP. TITLE Tight junction proteins in zebrafish ovarian follicles: stage specific mRNA abundance and response to 17beta-estradiol, human chorionic gonadotropin, and maturation inducing hormone JOURNAL Gen Comp Endocrinol 168 (3), 388-400 (2010) PUBMED 20553723 REFERENCE 8 (bases 1 to 1796) AUTHORS Loh YH, Christoffels A, Brenner S, Hunziker W and Venkatesh B. TITLE Extensive expansion of the claudin gene family in the teleost fish, Fugu rubripes JOURNAL Genome Res 14 (7), 1248-1257 (2004) PUBMED 15197168 COMMENT VALIDATED REFSEQ: This record has undergone validation or preliminary review. The reference sequence was derived from CR382327.27. On Jan 6, 2017 this sequence version replaced NM_131766.1. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1796 CR382327.27 83272-85067 FEATURES Location/Qualifiers source 1..1796 /organism="Danio rerio" /mol_type="mRNA" /strain="Tuebingen" /db_xref="taxon:7955" /chromosome="15" /map="15" gene 1..1796 /gene="cldnf" /gene_synonym="cldn28d; sr:nyz177; wu:fb13d10; zgc:109866" /note="claudin f" /db_xref="GeneID:81585" /db_xref="ZFIN:ZDB-GENE-010328-6" exon 1..1796 /gene="cldnf" /gene_synonym="cldn28d; sr:nyz177; wu:fb13d10; zgc:109866" /inference="alignment:Splign:2.1.0" CDS 8..709 /gene="cldnf" /gene_synonym="cldn28d; sr:nyz177; wu:fb13d10; zgc:109866" /codon_start=1 /product="claudin f" /protein_id="NP_571841.2" /db_xref="GeneID:81585" /db_xref="ZFIN:ZDB-GENE-010328-6" /translation="
MGRIAKEVAGQTLCFIGFVGICICCGIPMWRVTTYIGANIVTGQIVWDGLWMNCVMQSTGQMQCKIQDSIMNLTQDLQVARALVIISILIGFMGMLLTFIGGQCSSCLKNESSMAKVLILGGILCIVAGVLLLIPVCWSAAYTISDYVSVTTIQTQKRELGASIYVGWGASAFLLFGGIILCTSCPPRENIYPQYPGMYPYQGPVYGHQYAPSTVYKPYHPPVAYTPAPRQYL"
misc_feature 26..550 /gene="cldnf" /gene_synonym="cldn28d; sr:nyz177; wu:fb13d10; zgc:109866" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN
cttcaatatgggaaggattgctaaagaagtggccggccagaccctgtgcttcatcggttttgtgggcatctgcatctgctgtggcattcccatgtggcgggtcaccacctacatcggcgccaacatcgtgacaggccagatcgtgtgggacggcctgtggatgaactgcgtgatgcagagcacgggacagatgcagtgcaaaatacaggactccatcatgaacctgacccaggatctgcaggtggcgcgcgcactggtcatcatctccatactgatcggattcatgggcatgctgctgacgtttattggtggacagtgcagtagctgcctgaagaacgagtcctccatggctaaagtgctcattctgggaggcatcctgtgcattgttgctggagtcctgcttctgattcctgtgtgctggtctgcggcgtacaccatctccgattatgttagtgtgaccaccattcagacgcaaaagagagagcttggagcgtctatatatgtcggctggggtgcttcagcgttcctgttattcggagggattattctgtgcacttcttgcccacccagagaaaatatctacccacagtacccaggcatgtacccgtaccagggaccggtgtatgggcatcagtacgctccgagtacagtttacaaaccgtatcatcctcctgttgcttatacacctgctccaaggcaatatctttaacacaaaggacggacgtcgtctaaagactactcctgaagatggaaagaattgtgttgagctgaatcaaaacaattcttgagtttttggggagacaatttaaatgttttaagctcaatcaacctcaatttgtaaagacatttaagttgacttgatcgatttgtgttgggacagcatggagggattgtgtggaactcaacacttatagcgtgtatctgtattttaaagtgataattcacccaaaaatgaagattctgtcatcatttactcactatttttgtttttatttcttgttaagcacagaaaggaaggaaactggaaacctgtaaccattgacttccattgtatttgttgtactcaatggtttcagtcagtcagcattcttcaaaatatcttcctttgtgttcaacagaaactggtaaaggtttggaaacacttgagggagaataaataaggcggtaaatgtagatttttgtgtgaactgtccctttaattcagtgtttatctgaattgaatgtatttaaaagcaattttattgaggtcttgtacttccccaagctttaaacgaagatgatctggaaaagctaaaacttgttggtcttgtttttgagattttcgcagtgctaatgaatgatgtttgtttcaacatggtcatatttgaaggtactataaagtatatttcttgactgactctctgaataaatactctaatgccattaatctgatcaaaatcaagatcacaaagactttttacttccaaaaactctttactccaacatatttctcaaggaggaacaatataaagacaatatctgttgcatattcatctgctccgtcaatatctttaactcaaaggacggacatcttctaaaactgctcctgaagatggaaagaattgtgttgagctgaatcaaaacaattcttgagtttttgaggagacaatttaattgttttaagctcaatcaacctcaatttgtaaagacatttaagttgacttgatcgatttgtgttgggacagcatgaagggattgtgcggaactcaacatttacagcgtatatctgtattttaaagtgataattcacccaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]