LOCUS       NM_001100629             975 bp    mRNA    linear   VRT 03-APR-2024
DEFINITION  Danio rerio taste receptor, type 2, member 202 (tas2r202), mRNA.
ACCESSION   NM_001100629 XM_001339344
VERSION     NM_001100629.1
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 975)
  AUTHORS   Kowatschew,D. and Korsching,S.I.
  TITLE     An Ancient Adenosine Receptor Gains Olfactory Function in Bony
            Vertebrates
  JOURNAL   Genome Biol Evol 13 (9) (2021)
   PUBMED   34499158
REFERENCE   2  (bases 1 to 975)
  AUTHORS   Behrens,M., Di Pizio,A., Redel,U., Meyerhof,W. and Korsching,S.I.
  TITLE     At the Root of T2R Gene Evolution: Recognition Profiles of
            Coelacanth and Zebrafish Bitter Receptors
  JOURNAL   Genome Biol Evol 13 (1) (2021)
   PUBMED   33355666
REFERENCE   3  (bases 1 to 975)
  AUTHORS   Wang,S., Ji,D., Yang,Q., Li,M., Ma,Z., Zhang,S. and Li,H.
  TITLE     NEFLb impairs early nervous system development via regulation of
            neuron apoptosis in zebrafish
  JOURNAL   J Cell Physiol 234 (7), 11208-11218 (2019)
   PUBMED   30569449
REFERENCE   4  (bases 1 to 975)
  AUTHORS   Pasquier,J., Cabau,C., Nguyen,T., Jouanno,E., Severac,D.,
            Braasch,I., Journot,L., Pontarotti,P., Klopp,C., Postlethwait,J.H.,
            Guiguen,Y. and Bobe,J.
  TITLE     Gene evolution and gene expression after whole genome duplication
            in fish: the PhyloFish database
  JOURNAL   BMC Genomics 17, 368 (2016)
   PUBMED   27189481
  REMARK    Publication Status: Online-Only
REFERENCE   5  (bases 1 to 975)
  AUTHORS   Ohmoto,M., Okada,S., Nakamura,S., Abe,K. and Matsumoto,I.
  TITLE     Mutually exclusive expression of Galphaia and Galpha14 reveals
            diversification of taste receptor cells in zebrafish
  JOURNAL   J Comp Neurol 519 (8), 1616-1629 (2011)
   PUBMED   21452212
REFERENCE   6  (bases 1 to 975)
  AUTHORS   Oike,H., Nagai,T., Furuyama,A., Okada,S., Aihara,Y., Ishimaru,Y.,
            Marui,T., Matsumoto,I., Misaka,T. and Abe,K.
  TITLE     Characterization of ligands for fish taste receptors
  JOURNAL   J Neurosci 27 (21), 5584-5592 (2007)
   PUBMED   17522303
REFERENCE   7  (bases 1 to 975)
  AUTHORS   Ishimaru,Y., Okada,S., Naito,H., Nagai,T., Yasuoka,A., Matsumoto,I.
            and Abe,K.
  TITLE     Two families of candidate taste receptors in fishes
  JOURNAL   Mech Dev 122 (12), 1310-1321 (2005)
   PUBMED   16274966
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AB290688.1.
            
            On Aug 8, 2007 this sequence version replaced XM_001339344.1.
FEATURES             Location/Qualifiers
     source          1..975
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /db_xref="taxon:7955"
                     /chromosome="8"
                     /map="8"
     gene            1..975
                     /gene="tas2r202"
                     /gene_synonym="drT2R1; tas2r5"
                     /note="taste receptor, type 2, member 202"
                     /db_xref="GeneID:798975"
                     /db_xref="ZFIN:ZDB-GENE-070917-7"
     CDS             1..975
                     /gene="tas2r202"
                     /gene_synonym="drT2R1; tas2r5"
                     /note="taste receptor, type 2, member 5; zfT2R5"
                     /codon_start=1
                     /product="taste receptor, type 2, member 202"
                     /protein_id="NP_001094099.1"
                     /db_xref="GeneID:798975"
                     /db_xref="ZFIN:ZDB-GENE-070917-7"
                     /translation="

MLSTQDKLVAWLLIGVLAILTIFFNMYLLLVNYRSYRKKHKLNPADFIITAIAIASISQQVLTYSWQTMDVIDTVCQISLVEAILLVLVFSVKLIIFWSTAFLTFYYGTKLVVEPVHCYTRIQEAIVKHVHIVLTVIVVSGFANCVPLLSVLTYYNGTTELGDCGSIMPSDTPGLVYVFYYVVISDIIPGIVMFKCSISISYHLAKHLLDMKASSNGTHGPKLGTQMRVIKMTLSLVFVYSCFVVVDIYTQTTVVLMRQNTLALIMLFASIYTTVSAFVLIYGKKSYWKELIASYNLFLDEYPCLNKMKVEEVKHEPHEHSHGH"

     misc_feature    34..720
                     /gene="tas2r202"
                     /gene_synonym="drT2R1; tas2r5"
                     /note="rhodopsin receptor-like class A family of the
                     seven-transmembrane G protein-coupled receptor
                     superfamily; Region: 7tm_classA_rhodopsin-like; cd00637"
                     /db_xref="CDD:410626"
     misc_feature    34..105
                     /gene="tas2r202"
                     /gene_synonym="drT2R1; tas2r5"
                     /note="TM helix 1 [structural motif]; Region: TM helix 1"
                     /db_xref="CDD:410626"
     misc_feature    226..339
                     /gene="tas2r202"
                     /gene_synonym="drT2R1; tas2r5"
                     /note="TM helix 3 [structural motif]; Region: TM helix 3"
                     /db_xref="CDD:410626"
     misc_feature    385..444
                     /gene="tas2r202"
                     /gene_synonym="drT2R1; tas2r5"
                     /note="TM helix 4 [structural motif]; Region: TM helix 4"
                     /db_xref="CDD:410626"
     misc_feature    520..597
                     /gene="tas2r202"
                     /gene_synonym="drT2R1; tas2r5"
                     /note="TM helix 5 [structural motif]; Region: TM helix 5"
                     /db_xref="CDD:410626"
     exon            1..975
                     /gene="tas2r202"
                     /gene_synonym="drT2R1; tas2r5"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      

atgctgtcgactcaagacaaactggtggcctggctgctgatcggcgtactggcgatcctgaccatcttcttcaacatgtatctgcttctagtcaactatagaagctacagaaaaaagcacaagctgaacccggcagacttcattattacagcaatcgccattgccagcatctcccagcaggtcctgacgtactcctggcagaccatggatgtgatcgacaccgtttgccaaatcagtctggtggaggccatattgttagtcctcgttttcagtgtgaagctcatcatattctggagcacggcctttctgactttttactatggcacgaaattagttgttgagcccgttcattgttacacaagaatccaagaagccattgtgaaacacgtccacattgtgttgacggtgatagttgtgagtggctttgcgaattgcgttcccttattgagtgtgttgacgtattacaatggcaccaccgaattgggcgattgtgggtctataatgccaagcgatacgcctgggcttgtctacgtcttctattacgttgtaatttctgacatcattccgggaatcgttatgttcaaatgcagcatttctatatcgtatcacttggcgaagcatcttctggacatgaaggcgagcagcaatggcactcacgggcctaaactcggcactcagatgcgggtgatcaagatgacgctcagtttggtgttcgtttacagctgttttgttgttgtggacatttacacgcagaccacggtggtgttgatgcggcagaacacactggctttgattatgctgttcgccagtatttacaccacagtcagtgcgttcgtgctgatttatgggaagaaaagctactggaaggagttgatcgcctcttataacctctttttagacgagtatccttgtttgaataaaatgaaggtcgaggaggtcaaacatgagccgcatgaacacagtcacgggcactaa

//