ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2024-11-01 10:31:30, GGRNA.v2 : RefSeq release 226 (Sep, 2024)
LOCUS NM_001005596 1177 bp mRNA linear VRT 01-SEP-2024
DEFINITION Danio rerio RNA binding fox-1 homolog 1 (rbfox1), mRNA.
ACCESSION NM_001005596
VERSION NM_001005596.1
KEYWORDS RefSeq.
SOURCE Danio rerio (zebrafish)
ORGANISM Danio rerio
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE 1 (bases 1 to 1177)
AUTHORS Anton-Galindo,E., Adel,M.R., Garcia-Gonzalez,J., Leggieri,A.,
Lopez-Blanch,L., Irimia,M., Norton,W.H.J., Brennan,C.H.,
Fernandez-Castillo,N. and Cormand,B.
TITLE Pleiotropic contribution of rbfox1 to psychiatric and
neurodevelopmental phenotypes in two zebrafish models
JOURNAL Transl Psychiatry 14 (1), 99 (2024)
PUBMED 38374212
REMARK GeneRIF: Pleiotropic contribution of rbfox1 to psychiatric and
neurodevelopmental phenotypes in two zebrafish models.
Publication Status: Online-Only
REFERENCE 2 (bases 1 to 1177)
AUTHORS Quint,W.H., Tadema,K.C.D., Kokke,N.C.C.J., Meester-Smoor,M.A.,
Miller,A.C., Willemsen,R., Klaver,C.C.W. and Iglesias,A.I.
TITLE Post-GWAS screening of candidate genes for refractive error in
mutant zebrafish models
JOURNAL Sci Rep 13 (1), 2017 (2023)
PUBMED 36737489
REMARK Publication Status: Online-Only
REFERENCE 3 (bases 1 to 1177)
AUTHORS Ma,J., Gu,Y., Liu,J., Song,J., Zhou,T., Jiang,M., Wen,Y., Guo,X.,
Zhou,Z., Sha,J., He,J., Hu,Z., Luo,L. and Liu,M.
TITLE Functional screening of congenital heart disease risk loci
identifies 5 genes essential for heart development in zebrafish
JOURNAL Cell Mol Life Sci 80 (1), 19 (2022)
PUBMED 36574072
REMARK Publication Status: Online-Only
REFERENCE 4 (bases 1 to 1177)
AUTHORS Huang,M., Akerberg,A.A., Zhang,X., Yoon,H., Joshi,S., Hallinan,C.,
Nguyen,C., Pu,W.T., Haigis,M.C., Burns,C.G. and Burns,C.E.
TITLE Intrinsic myocardial defects underlie an Rbfox-deficient zebrafish
model of hypoplastic left heart syndrome
JOURNAL Nat Commun 13 (1), 5877 (2022)
PUBMED 36198703
REMARK Publication Status: Online-Only
REFERENCE 5 (bases 1 to 1177)
AUTHORS Zhong,Y., Zhang,N., Zhao,F., Chang,S., Chen,W., Cao,Q., Sun,L.,
Wang,Y., Gong,Z., Lu,L., Liu,D. and Yang,L.
TITLE RBFOX1 and Working Memory: From Genome to Transcriptome Revealed
Posttranscriptional Mechanism Separate From
Attention-Deficit/Hyperactivity Disorder
JOURNAL Biol Psychiatry Glob Open Sci 3 (4), 1042-1052 (2022)
PUBMED 37881587
REMARK Publication Status: Online-Only
REFERENCE 6 (bases 1 to 1177)
AUTHORS Frese,K.S., Meder,B., Keller,A., Just,S., Haas,J., Vogel,B.,
Fischer,S., Backes,C., Matzas,M., Kohler,D., Benes,V., Katus,H.A.
and Rottbauer,W.
TITLE RNA splicing regulated by RBFOX1 is essential for cardiac function
in zebrafish
JOURNAL J Cell Sci 128 (16), 3030-3040 (2015)
PUBMED 26116573
REMARK GeneRIF: This study underlines that tightly regulated splicing is
necessary for unconstrained cardiac function and renders the
splicing regulator rbfox1 an interesting target for investigation
in human heart failure and cardiomyopathy.
REFERENCE 7 (bases 1 to 1177)
AUTHORS Aoki,M., Segawa,H., Naito,M. and Okamoto,H.
TITLE Identification of possible downstream genes required for the
extension of peripheral axons in primary sensory neurons
JOURNAL Biochem Biophys Res Commun 445 (2), 357-362 (2014)
PUBMED 24513284
REFERENCE 8 (bases 1 to 1177)
AUTHORS Amir-Zilberstein,L., Blechman,J., Sztainberg,Y., Norton,W.H.,
Reuveny,A., Borodovsky,N., Tahor,M., Bonkowsky,J.L., Bally-Cuif,L.,
Chen,A. and Levkowitz,G.
TITLE Homeodomain protein otp and activity-dependent splicing modulate
neuronal adaptation to stress
JOURNAL Neuron 73 (2), 279-291 (2012)
PUBMED 22284183
REFERENCE 9 (bases 1 to 1177)
AUTHORS Gallagher,T.L., Arribere,J.A., Geurts,P.A., Exner,C.R.,
McDonald,K.L., Dill,K.K., Marr,H.L., Adkar,S.S., Garnett,A.T.,
Amacher,S.L. and Conboy,J.G.
TITLE Rbfox-regulated alternative splicing is critical for zebrafish
cardiac and skeletal muscle functions
JOURNAL Dev Biol 359 (2), 251-261 (2011)
PUBMED 21925157
REFERENCE 10 (bases 1 to 1177)
AUTHORS Kurrasch,D.M., Cheung,C.C., Lee,F.Y., Tran,P.V., Hata,K. and
Ingraham,H.A.
TITLE The neonatal ventromedial hypothalamus transcriptome reveals novel
markers with spatially distinct patterning
JOURNAL J Neurosci 27 (50), 13624-13634 (2007)
PUBMED 18077674
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. The reference sequence was derived from BC081500.1.
Publication Note: This RefSeq record includes a subset of the
publications that are available for this gene. Please see the Gene
record to access additional publications.
##Evidence-Data-START##
Transcript exon combination :: BC081500.1 [ECO:0000332]
RNAseq introns :: mixed/partial sample support
SAMEA2168446, SAMEA2168447
[ECO:0000350]
##Evidence-Data-END##
FEATURES Location/Qualifiers
source 1..1177
/organism="Danio rerio"
/mol_type="mRNA"
/db_xref="taxon:7955"
/chromosome="3"
/map="3"
gene 1..1177
/gene="rbfox1"
/gene_synonym="a2bp1; fox1; zgc:103635"
/note="RNA binding fox-1 homolog 1"
/db_xref="GeneID:449554"
/db_xref="ZFIN:ZDB-GENE-040927-11"
exon 1..73
/gene="rbfox1"
/gene_synonym="a2bp1; fox1; zgc:103635"
/inference="alignment:Splign:2.1.0"
misc_feature 35..37
/gene="rbfox1"
/gene_synonym="a2bp1; fox1; zgc:103635"
/note="upstream in-frame stop codon"
CDS 41..1162
/gene="rbfox1"
/gene_synonym="a2bp1; fox1; zgc:103635"
/note="fox-1 homolog A; ataxin-2-binding protein 1"
/codon_start=1
/product="RNA binding protein fox-1 homolog 1"
/protein_id="NP_001005596.1"
/db_xref="GeneID:449554"
/db_xref="ZFIN:ZDB-GENE-040927-11"
/translation="
MEEKGSKMVEQGNQDAPAPPETMAQPFPSAQFAPPQNGIPAEYTPSHPHPTPDYSGQTPVAEHTLNLYTPAQTHSEPSGPDNSIQAVSGTATQTDDSAQTDSQQQTQSSEITEIKTQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFESSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKTVNPYANGWKLNPVVGAVYSPEFYAVPGFPYPAATAAAAAYRGAHLRGRGRTVYNTFRAAAPPPHIPAYGGVVYQDGFYGADIYGGYTAYRYTQPATATAAAYSDSYGRVYAADPYNHALAPAATYSVGAMNAFAPLTDAKTRSHADDVGLVLSSLQASIYRGGYSRFAPY"
misc_feature 41..394
/gene="rbfox1"
/gene_synonym="a2bp1; fox1; zgc:103635"
/note="propagated from UniProtKB/Swiss-Prot (Q642J5.1);
Region: Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite"
misc_feature 395..622
/gene="rbfox1"
/gene_synonym="a2bp1; fox1; zgc:103635"
/note="RNA recognition motif (RRM) found in vertebrate RNA
binding protein fox-1 homologs and similar proteins;
Region: RRM_FOX1_like; cd12407"
/db_xref="CDD:409841"
misc_feature order(398..400,404..406,410..427,485..499,503..520,
524..526,596..598,611..622)
/gene="rbfox1"
/gene_synonym="a2bp1; fox1; zgc:103635"
/note="RNA binding site [nucleotide binding]; other site"
/db_xref="CDD:409841"
misc_feature 398..400
/gene="rbfox1"
/gene_synonym="a2bp1; fox1; zgc:103635"
/note="Interaction with RNA. /evidence=ECO:0000250;
propagated from UniProtKB/Swiss-Prot (Q642J5.1); other
site"
misc_feature 422..424
/gene="rbfox1"
/gene_synonym="a2bp1; fox1; zgc:103635"
/note="Interaction with RNA. /evidence=ECO:0000250;
propagated from UniProtKB/Swiss-Prot (Q642J5.1); other
site"
misc_feature 425..427
/gene="rbfox1"
/gene_synonym="a2bp1; fox1; zgc:103635"
/note="Interaction with RNA. /evidence=ECO:0000250;
propagated from UniProtKB/Swiss-Prot (Q642J5.1); other
site"
misc_feature 497..499
/gene="rbfox1"
/gene_synonym="a2bp1; fox1; zgc:103635"
/note="Interaction with RNA. /evidence=ECO:0000250;
propagated from UniProtKB/Swiss-Prot (Q642J5.1); other
site"
misc_feature 512..514
/gene="rbfox1"
/gene_synonym="a2bp1; fox1; zgc:103635"
/note="Interaction with RNA. /evidence=ECO:0000250;
propagated from UniProtKB/Swiss-Prot (Q642J5.1); other
site"
misc_feature 524..526
/gene="rbfox1"
/gene_synonym="a2bp1; fox1; zgc:103635"
/note="Interaction with RNA. /evidence=ECO:0000250;
propagated from UniProtKB/Swiss-Prot (Q642J5.1); other
site"
misc_feature 596..598
/gene="rbfox1"
/gene_synonym="a2bp1; fox1; zgc:103635"
/note="Interaction with RNA. /evidence=ECO:0000250;
propagated from UniProtKB/Swiss-Prot (Q642J5.1); other
site"
misc_feature 626..628
/gene="rbfox1"
/gene_synonym="a2bp1; fox1; zgc:103635"
/note="Interaction with RNA. /evidence=ECO:0000250;
propagated from UniProtKB/Swiss-Prot (Q642J5.1); other
site"
misc_feature 722..994
/gene="rbfox1"
/gene_synonym="a2bp1; fox1; zgc:103635"
/note="Calcitonin gene-related peptide regulator C
terminal; Region: Fox-1_C; pfam12414"
/db_xref="CDD:463568"
exon 74..316
/gene="rbfox1"
/gene_synonym="a2bp1; fox1; zgc:103635"
/inference="alignment:Splign:2.1.0"
exon 317..460
/gene="rbfox1"
/gene_synonym="a2bp1; fox1; zgc:103635"
/inference="alignment:Splign:2.1.0"
exon 461..514
/gene="rbfox1"
/gene_synonym="a2bp1; fox1; zgc:103635"
/inference="alignment:Splign:2.1.0"
exon 515..607
/gene="rbfox1"
/gene_synonym="a2bp1; fox1; zgc:103635"
/inference="alignment:Splign:2.1.0"
exon 608..668
/gene="rbfox1"
/gene_synonym="a2bp1; fox1; zgc:103635"
/inference="alignment:Splign:2.1.0"
exon 669..722
/gene="rbfox1"
/gene_synonym="a2bp1; fox1; zgc:103635"
/inference="alignment:Splign:2.1.0"
exon 723..858
/gene="rbfox1"
/gene_synonym="a2bp1; fox1; zgc:103635"
/inference="alignment:Splign:2.1.0"
exon 859..898
/gene="rbfox1"
/gene_synonym="a2bp1; fox1; zgc:103635"
/inference="alignment:Splign:2.1.0"
exon 899..963
/gene="rbfox1"
/gene_synonym="a2bp1; fox1; zgc:103635"
/inference="alignment:Splign:2.1.0"
exon 964..1039
/gene="rbfox1"
/gene_synonym="a2bp1; fox1; zgc:103635"
/inference="alignment:Splign:2.1.0"
exon 1040..1164
/gene="rbfox1"
/gene_synonym="a2bp1; fox1; zgc:103635"
/inference="alignment:Splign:2.1.0"
ORIGIN
agatgctgcagggattgggactaaggcagctgcttagtttatggaggaaaaagggagcaagatggtggaacagggtaatcaagacgccccagcacccccagaaaccatggcccagcctttcccatcggcccagttcgctccccctcagaacggcattcctgctgagtacacgccgtcccaccctcacccgaccccagactactcgggccagaccccggtggcagagcacacgctgaacttgtacacccctgcccaaacgcacagtgagcccagcggaccagacaacagcatacaggcggtctccggcacagccacacagacagacgattcagcacagacagacagccaacagcaaacacagtcatccgaaatcacagaaatcaaaacgcagcccaagaggctccacgtctccaacatccccttcaggttcagagatccagacctcaggcaaatgtttggccaatttggtaaaatcttagatgttgaaatcatatttaatgaacgaggatcaaagggttttggtttcgtaactttcgaaagtagtgccgatgcggacagggccagagagaaattacacggcacggtggtagaaggtcgtaaaatagaggttaacaatgcaacagcacgggtaatgacgaataaaaagacagtcaacccatatgcaaatggctggaagttgaatccagtcgtgggtgcagtctacagcccagaattctatgcagtgccaggcttcccatacccagcagccacggcggcagcggcggcgtacagaggggcacacttaagaggaagaggccgcaccgtctacaacacgtttcgggcagccgcgcctcccccacacatcccagcctatggaggtgttgtttaccaggacgggttttacggtgcagatatttatggtggttacactgcctaccgatacactcagcctgctactgctaccgccgctgcctacagtgacagttacggacgagtttatgctgccgacccctacaaccacgcacttgctccagcagccacatacagcgttggtgccatgaatgctttcgcacccttgactgatgccaagaccagaagccacgccgatgatgtgggtctcgttctttcttctttgcaggctagtatataccgaggtggatacagtcgtttcgcgccatattaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]