GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-11-01 10:22:21, GGRNA.v2 : RefSeq release 226 (Sep, 2024)

LOCUS       NM_001002507             659 bp    mRNA    linear   VRT 03-APR-2024
DEFINITION  Danio rerio neuritin 1a (nrn1a), mRNA.
ACCESSION   NM_001002507
VERSION     NM_001002507.2
KEYWORDS    RefSeq.
SOURCE      Danio rerio (zebrafish)
  ORGANISM  Danio rerio
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Ostariophysi;
            Cypriniformes; Danionidae; Danioninae; Danio.
REFERENCE   1  (bases 1 to 659)
  AUTHORS   Pasquier,J., Cabau,C., Nguyen,T., Jouanno,E., Severac,D.,
            Braasch,I., Journot,L., Pontarotti,P., Klopp,C., Postlethwait,J.H.,
            Guiguen,Y. and Bobe,J.
  TITLE     Gene evolution and gene expression after whole genome duplication
            in fish: the PhyloFish database
  JOURNAL   BMC Genomics 17, 368 (2016)
   PUBMED   27189481
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 659)
  AUTHORS   Elkon,R., Milon,B., Morrison,L., Shah,M., Vijayakumar,S.,
            Racherla,M., Leitch,C.C., Silipino,L., Hadi,S., Weiss-Gayet,M.,
            Barras,E., Schmid,C.D., Ait-Lounis,A., Barnes,A., Song,Y.,
            Eisenman,D.J., Eliyahu,E., Frolenkov,G.I., Strome,S.E., Durand,B.,
            Zaghloul,N.A., Jones,S.M., Reith,W. and Hertzano,R.
  TITLE     RFX transcription factors are essential for hearing in mice
  JOURNAL   Nat Commun 6, 8549 (2015)
   PUBMED   26469318
  REMARK    Publication Status: Online-Only
REFERENCE   3  (bases 1 to 659)
  AUTHORS   Briolat,V., Jouneau,L., Carvalho,R., Palha,N., Langevin,C.,
            Herbomel,P., Schwartz,O., Spaink,H.P., Levraud,J.P. and Boudinot,P.
  TITLE     Contrasted innate responses to two viruses in zebrafish: insights
            into the ancestral repertoire of vertebrate IFN-stimulated genes
  JOURNAL   J Immunol 192 (9), 4328-4341 (2014)
   PUBMED   24683187
REFERENCE   4  (bases 1 to 659)
  AUTHORS   Aoki,M., Segawa,H., Naito,M. and Okamoto,H.
  TITLE     Identification of possible downstream genes required for the
            extension of peripheral axons in primary sensory neurons
  JOURNAL   Biochem Biophys Res Commun 445 (2), 357-362 (2014)
   PUBMED   24513284
REFERENCE   5  (bases 1 to 659)
  AUTHORS   Akten,B., Kye,M.J., Hao le,T., Wertz,M.H., Singh,S., Nie,D.,
            Huang,J., Merianda,T.T., Twiss,J.L., Beattie,C.E., Steen,J.A. and
            Sahin,M.
  TITLE     Interaction of survival of motor neuron (SMN) and HuD proteins with
            mRNA cpg15 rescues motor neuron axonal deficits
  JOURNAL   Proc Natl Acad Sci U S A 108 (25), 10337-10342 (2011)
   PUBMED   21652774
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BC076292.1.
            
            On Aug 30, 2012 this sequence version replaced NM_001002507.1.
            
            ##Evidence-Data-START##
            Transcript exon combination :: BC076292.1, CK360545.1 [ECO:0000332]
            RNAseq introns              :: single sample supports all introns
                                           SAMEA2168446, SAMEA2168447
                                           [ECO:0000348]
            ##Evidence-Data-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-659               BC076292.1         3-661
FEATURES             Location/Qualifiers
     source          1..659
                     /organism="Danio rerio"
                     /mol_type="mRNA"
                     /db_xref="taxon:7955"
                     /chromosome="24"
                     /map="24"
     gene            1..659
                     /gene="nrn1a"
                     /gene_synonym="nrn1; zgc:92828"
                     /note="neuritin 1a"
                     /db_xref="GeneID:436780"
                     /db_xref="ZFIN:ZDB-GENE-040718-212"
     exon            1..219
                     /gene="nrn1a"
                     /gene_synonym="nrn1; zgc:92828"
                     /inference="alignment:Splign:2.1.0"
     misc_feature    66..68
                     /gene="nrn1a"
                     /gene_synonym="nrn1; zgc:92828"
                     /note="upstream in-frame stop codon"
     CDS             165..593
                     /gene="nrn1a"
                     /gene_synonym="nrn1; zgc:92828"
                     /note="neuritin 1; cpg15"
                     /codon_start=1
                     /product="neuritin precursor"
                     /protein_id="NP_001002507.1"
                     /db_xref="GeneID:436780"
                     /db_xref="ZFIN:ZDB-GENE-040718-212"
                     /translation="
MGLTLSGRYISLFLAVQIAYLLQAVRAAGKCGTVFKGFSDCLLQLGENMANYPQELDEKENLQTICTYWDDFHSCATTALADCQEGATDLWEKLKKESRNLDFRGSLFELCAGGNGAIRSSVPFGVTLLITALSALVTWMQF"
     sig_peptide     165..245
                     /gene="nrn1a"
                     /gene_synonym="nrn1; zgc:92828"
                     /inference="COORDINATES: ab initio prediction:SignalP:6.0"
     mat_peptide     246..500
                     /gene="nrn1a"
                     /gene_synonym="nrn1; zgc:92828"
                     /product="Neuritin. /id=PRO_0000262518"
                     /note="propagated from UniProtKB/Swiss-Prot (Q6DGP8.1)"
     misc_feature    255..515
                     /gene="nrn1a"
                     /gene_synonym="nrn1; zgc:92828"
                     /note="Neuritin protein family; Region: NRN1; pfam15056"
                     /db_xref="CDD:434424"
     exon            220..364
                     /gene="nrn1a"
                     /gene_synonym="nrn1; zgc:92828"
                     /inference="alignment:Splign:2.1.0"
     exon            365..646
                     /gene="nrn1a"
                     /gene_synonym="nrn1; zgc:92828"
                     /inference="alignment:Splign:2.1.0"
ORIGIN      
tttcacttctctgcgcctcgccgacatcggaaaaaaaaatcacaaagagtttctgaatagctgcttgaactgaaccgcgatgtacaacgctcagatttggcaatcttttcccctcacaaccatctaaaattggcatatactccaatggttttactggacgtacgatgggattaactttgtctggaagatatatttcattgtttcttgctgttcaaatagcctatctgctgcaggcggttcgagcggctgggaaatgtggaacagtgttcaaaggtttctccgactgcctgcttcaactgggagagaacatggccaactatccacaggagctggacgagaaggaaaaccttcagaccatctgcacttactgggatgatttccattcatgtgcgaccactgctctggcagactgtcaggagggagccacagatctgtgggagaagctgaaaaaagagtccagaaatctggactttcgcggcagcttgtttgaactgtgtgctggcggaaacggcgcaatccggtcatcggttccgttcggcgtaacgctgctcataacggcactgtctgcgcttgtgacgtggatgcagttttaacccacgggaagattaaaaaaataagcagagaagaaaaaaagaagagcgaaaaaaaaaaaaaaaaaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]