2024-11-01 10:22:21, GGRNA.v2 : RefSeq release 226 (Sep, 2024)
LOCUS NM_001002507 659 bp mRNA linear VRT 03-APR-2024 DEFINITION Danio rerio neuritin 1a (nrn1a), mRNA. ACCESSION NM_001002507 VERSION NM_001002507.2 KEYWORDS RefSeq. SOURCE Danio rerio (zebrafish) ORGANISM Danio rerio Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Danionidae; Danioninae; Danio. REFERENCE 1 (bases 1 to 659) AUTHORS Pasquier,J., Cabau,C., Nguyen,T., Jouanno,E., Severac,D., Braasch,I., Journot,L., Pontarotti,P., Klopp,C., Postlethwait,J.H., Guiguen,Y. and Bobe,J. TITLE Gene evolution and gene expression after whole genome duplication in fish: the PhyloFish database JOURNAL BMC Genomics 17, 368 (2016) PUBMED 27189481 REMARK Publication Status: Online-Only REFERENCE 2 (bases 1 to 659) AUTHORS Elkon,R., Milon,B., Morrison,L., Shah,M., Vijayakumar,S., Racherla,M., Leitch,C.C., Silipino,L., Hadi,S., Weiss-Gayet,M., Barras,E., Schmid,C.D., Ait-Lounis,A., Barnes,A., Song,Y., Eisenman,D.J., Eliyahu,E., Frolenkov,G.I., Strome,S.E., Durand,B., Zaghloul,N.A., Jones,S.M., Reith,W. and Hertzano,R. TITLE RFX transcription factors are essential for hearing in mice JOURNAL Nat Commun 6, 8549 (2015) PUBMED 26469318 REMARK Publication Status: Online-Only REFERENCE 3 (bases 1 to 659) AUTHORS Briolat,V., Jouneau,L., Carvalho,R., Palha,N., Langevin,C., Herbomel,P., Schwartz,O., Spaink,H.P., Levraud,J.P. and Boudinot,P. TITLE Contrasted innate responses to two viruses in zebrafish: insights into the ancestral repertoire of vertebrate IFN-stimulated genes JOURNAL J Immunol 192 (9), 4328-4341 (2014) PUBMED 24683187 REFERENCE 4 (bases 1 to 659) AUTHORS Aoki,M., Segawa,H., Naito,M. and Okamoto,H. TITLE Identification of possible downstream genes required for the extension of peripheral axons in primary sensory neurons JOURNAL Biochem Biophys Res Commun 445 (2), 357-362 (2014) PUBMED 24513284 REFERENCE 5 (bases 1 to 659) AUTHORS Akten,B., Kye,M.J., Hao le,T., Wertz,M.H., Singh,S., Nie,D., Huang,J., Merianda,T.T., Twiss,J.L., Beattie,C.E., Steen,J.A. and Sahin,M. TITLE Interaction of survival of motor neuron (SMN) and HuD proteins with mRNA cpg15 rescues motor neuron axonal deficits JOURNAL Proc Natl Acad Sci U S A 108 (25), 10337-10342 (2011) PUBMED 21652774 COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. The reference sequence was derived from BC076292.1. On Aug 30, 2012 this sequence version replaced NM_001002507.1. ##Evidence-Data-START## Transcript exon combination :: BC076292.1, CK360545.1 [ECO:0000332] RNAseq introns :: single sample supports all introns SAMEA2168446, SAMEA2168447 [ECO:0000348] ##Evidence-Data-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-659 BC076292.1 3-661 FEATURES Location/Qualifiers source 1..659 /organism="Danio rerio" /mol_type="mRNA" /db_xref="taxon:7955" /chromosome="24" /map="24" gene 1..659 /gene="nrn1a" /gene_synonym="nrn1; zgc:92828" /note="neuritin 1a" /db_xref="GeneID:436780" /db_xref="ZFIN:ZDB-GENE-040718-212" exon 1..219 /gene="nrn1a" /gene_synonym="nrn1; zgc:92828" /inference="alignment:Splign:2.1.0" misc_feature 66..68 /gene="nrn1a" /gene_synonym="nrn1; zgc:92828" /note="upstream in-frame stop codon" CDS 165..593 /gene="nrn1a" /gene_synonym="nrn1; zgc:92828" /note="neuritin 1; cpg15" /codon_start=1 /product="neuritin precursor" /protein_id="NP_001002507.1" /db_xref="GeneID:436780" /db_xref="ZFIN:ZDB-GENE-040718-212" /translation="
MGLTLSGRYISLFLAVQIAYLLQAVRAAGKCGTVFKGFSDCLLQLGENMANYPQELDEKENLQTICTYWDDFHSCATTALADCQEGATDLWEKLKKESRNLDFRGSLFELCAGGNGAIRSSVPFGVTLLITALSALVTWMQF"
sig_peptide 165..245 /gene="nrn1a" /gene_synonym="nrn1; zgc:92828" /inference="COORDINATES: ab initio prediction:SignalP:6.0" mat_peptide 246..500 /gene="nrn1a" /gene_synonym="nrn1; zgc:92828" /product="Neuritin. /id=PRO_0000262518" /note="propagated from UniProtKB/Swiss-Prot (Q6DGP8.1)" misc_feature 255..515 /gene="nrn1a" /gene_synonym="nrn1; zgc:92828" /note="Neuritin protein family; Region: NRN1; pfam15056" /db_xref="CDD:434424" exon 220..364 /gene="nrn1a" /gene_synonym="nrn1; zgc:92828" /inference="alignment:Splign:2.1.0" exon 365..646 /gene="nrn1a" /gene_synonym="nrn1; zgc:92828" /inference="alignment:Splign:2.1.0" ORIGIN
tttcacttctctgcgcctcgccgacatcggaaaaaaaaatcacaaagagtttctgaatagctgcttgaactgaaccgcgatgtacaacgctcagatttggcaatcttttcccctcacaaccatctaaaattggcatatactccaatggttttactggacgtacgatgggattaactttgtctggaagatatatttcattgtttcttgctgttcaaatagcctatctgctgcaggcggttcgagcggctgggaaatgtggaacagtgttcaaaggtttctccgactgcctgcttcaactgggagagaacatggccaactatccacaggagctggacgagaaggaaaaccttcagaccatctgcacttactgggatgatttccattcatgtgcgaccactgctctggcagactgtcaggagggagccacagatctgtgggagaagctgaaaaaagagtccagaaatctggactttcgcggcagcttgtttgaactgtgtgctggcggaaacggcgcaatccggtcatcggttccgttcggcgtaacgctgctcataacggcactgtctgcgcttgtgacgtggatgcagttttaacccacgggaagattaaaaaaataagcagagaagaaaaaaagaagagcgaaaaaaaaaaaaaaaaaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]