2025-07-08 15:40:20, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_026836336 734 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis claudin-1-like (LOC100179431), transcript variant X1, mRNA. ACCESSION XM_026836336 VERSION XM_026836336.1 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq. SOURCE Ciona intestinalis (vase tunicate) ORGANISM Ciona intestinalis Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Phlebobranchia; Cionidae; Ciona. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_020175.2) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Ciona intestinalis Annotation Release 104 Annotation Version :: 104 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.1 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..734 /organism="Ciona intestinalis" /mol_type="mRNA" /db_xref="taxon:7719" /chromosome="10" gene 1..734 /gene="LOC100179431" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 ESTs, 2 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 22 samples with support for all annotated introns" /db_xref="GeneID:100179431" CDS 75..725 /gene="LOC100179431" /codon_start=1 /product="claudin-1-like isoform X1" /protein_id="XP_026692137.1" /db_xref="GeneID:100179431" /translation="
MANACPSVGLALGILSTIGILYSLASKEWKRNSQNSSQNVNRGIYSYEGLWVRCTSPMPGQFQCDNYDESFLALPASLQAQRAMMCIAAIAAVAGIVAGALGLQCIKVMEGSNAKVHTGRAGGGLMFLAGALTIAAVSWYAADVVYQFHVEVITNQSFTYEFGSALYVGWIAGGCALISGALMACCNCGNEETDSYPAYTYKPPKASGGGNNTEYV"
misc_feature <201..620 /gene="LOC100179431" /note="PMP-22/EMP/MP20/Claudin family; Region: PMP22_Claudin; cl21598" /db_xref="CDD:473919" ORIGIN
ttattatttaaccaataacaagatttttgcagttttaagtatttaagtttacaagtttcataggataatcaaaaatggcgaacgcctgtccatcggtcggtttggctcttggcattctctctactattggaatcctgtactctctagcttccaaagaatggaaacgaaactcccaaaattcgtcccagaacgttaaccggggtatatactcgtatgagggtttatgggtaagatgcacaagtcccatgcccggacagtttcaatgtgacaactacgatgaatcatttcttgctttacccgcttcacttcaagctcaacgtgcaatgatgtgtattgcggcaatcgctgccgttgctggtattgtggctggagctcttggtctccaatgcattaaagtgatggaaggcagcaacgctaaggttcacaccggtcgagctggtggtggtttgatgttcctggcaggtgccctaactatcgcagctgtgtcctggtacgctgctgacgtagtgtaccagtttcatgtggaagtcattacaaaccaatcgtttacttatgagttcggttctgctctttatgttggttggatagctggcgggtgtgcacttatctccggggcactgatggcttgttgcaattgtggaaacgaagagactgacagttacccagcttacacctacaagcctcctaaagcatctgggggtggcaacaacacagaatatgtgtgatcacagaac
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]