GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-07-02 04:13:32, GGRNA.v2 : RefSeq release 224 (May, 2024)

LOCUS       XM_026834694             904 bp    mRNA    linear   INV 22-OCT-2018
DEFINITION  PREDICTED: Ciona intestinalis claudin-16-like (LOC100186332),
            transcript variant X2, mRNA.
ACCESSION   XM_026834694
VERSION     XM_026834694.1
DBLINK      BioProject: PRJNA187185
KEYWORDS    RefSeq.
SOURCE      Ciona intestinalis (vase tunicate)
  ORGANISM  Ciona intestinalis
            Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Phlebobranchia;
            Cionidae; Ciona.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_020170.2) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Ciona intestinalis Annotation
                                           Release 104
            Annotation Version          :: 104
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..904
                     /organism="Ciona intestinalis"
                     /mol_type="mRNA"
                     /db_xref="taxon:7719"
                     /chromosome="5"
     gene            1..904
                     /gene="LOC100186332"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 24 ESTs, and 100% coverage of the
                     annotated genomic feature by RNAseq alignments, including
                     15 samples with support for all annotated introns"
                     /db_xref="GeneID:100186332"
     CDS             118..822
                     /gene="LOC100186332"
                     /codon_start=1
                     /product="claudin-15-like isoform X2"
                     /protein_id="XP_026690495.1"
                     /db_xref="GeneID:100186332"
                     /translation="
MPKHRSRHTRIVMVFGNFAALPVCVENGFPVPFSARMELLISAQRTVCRGLMITACLLSGFALILNVMGMRCILLFRLLPRTKEKLTRRAAVVWIVAGTFVLISSTWYGLEVMYSVWDEGKASELSDGIFVGWGATAFAYAAAGLLWIGATVSRSERKEAEKRRDSILSTVAAAYAASRSGSGASTTCCCYLAPRLLGCGHECGHHSNTGDDKIRTLEPITECQVTSHARTTYM"
ORIGIN      
cagacagcgcttcgtctgtaatagcgccgttatgcaagtttgctggttttatttttggactgacagccgctagttgtgtagttttcgtgaccgtaactccttgttggtacgtcatctatgccgaagcatcgatctcgccatacgagaattgttatggtctttggaaattttgcagctctaccggtttgtgtggaaaatggctttccggttcccttctcggctcgcatggagttacttatttcagcgcagcggacagtatgcagaggtctcatgataactgcttgtctactaagtgggtttgctttgattcttaacgttatgggaatgcgatgcatcctgctttttcgtcttttaccacggacaaaagaaaagttaactcgacgtgcggctgttgtatggatagtagcaggtaccttcgtattaatatcaagcacctggtatggtctggaagtaatgtattcagtatgggatgaaggtaaagcttccgaactttcagacggtatatttgtgggttggggagcaactgcgtttgcttatgcagctgccgggctattgtggataggtgcaactgtatcgagaagtgaaaggaaagaagcagaaaaacgacgagattcgattttatcaacagtagccgcggcgtacgctgctagtcgcagtggttcaggggcaagcacgacttgttgctgctacttggcgcctcggctgctcggctgcggccacgagtgcgggcaccatagcaacacaggggacgacaagatacgaactctggaacccatcactgaatgtcaggtgacatcgcacgcaaggacaacatacatgtaatttagagaattcgagaaaattattaggaggcaagattcgtaaccgctgtttaaaagctctaataaaacagttcaacaaagca
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]