2025-09-18 19:54:59, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS XM_018813081 1104 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis uncharacterized oxidoreductase TM_0325-like (LOC100186091), mRNA. ACCESSION XM_018813081 VERSION XM_018813081.2 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq. SOURCE Ciona intestinalis (vase tunicate) ORGANISM Ciona intestinalis Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Phlebobranchia; Cionidae; Ciona. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_020173.2) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Oct 22, 2018 this sequence version replaced XM_018813081.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Ciona intestinalis Annotation Release 104 Annotation Version :: 104 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.1 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1104 /organism="Ciona intestinalis" /mol_type="mRNA" /db_xref="taxon:7719" /chromosome="8" gene 1..1104 /gene="LOC100186091" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 9 samples with support for all annotated introns" /db_xref="GeneID:100186091" CDS 288..1061 /gene="LOC100186091" /codon_start=1 /product="uncharacterized protein LOC100186091" /protein_id="XP_018668626.1" /db_xref="GeneID:100186091" /translation="
MAATKRVVLITGSATGIGAETAKGFAKEGASLCITGLPSQKDELAEVAKVCKENGSPHVLEVAADLRKQEDMYLLMNETIKTFGQLDVLVNNAGITVNGDLDQYTSEDFDKIFSVNVKAPTYLTKLAKPHLSKTKGNIVNMCSVVRECHIKNCLLYGMAKASLAYLTKSTAADFAENGIRCNAVSPGCIYGTDILKGILSDEFKQQYFDSCITKLRGRLATKSDVSDLIRFLASDKATMITGEIITIDGGKVLSLKS"
misc_feature 303..1037 /gene="LOC100186091" /note="NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family [Lipid transport and metabolism]; Region: FabG; COG1028" /db_xref="CDD:440651" ORIGIN
ttaaaggtgatataatgcgaaacgccaagaacgaagcaggggtatacgattcatcgcatcataagcaagtatagtctatatttcaattagggccgtgggctacacatacagaaatcgccctgtttacaatgcgatcatgaaagatacaagaatttgttccacgcaagagttatacgaagaaggagcggtgtagtcttgcccacaactaaatcgacgaactttgctattgtgcagtttgtctgtctggcatataacgacatttagctaacgtatatataaataataaaatggcagcaacaaaacgagttgttttgataacaggtagtgcgactggtataggtgccgaaactgctaaaggatttgcaaaggaaggagcctcattgtgcatcactgggttaccatcccagaaagatgaattggcagaagttgcgaaagtttgcaaagaaaatggatctccgcatgtattggaagtagcagctgatctaagaaaacaagaagatatgtatttgttgatgaatgaaacgatcaagacgtttggacaacttgatgtcttggttaacaacgcaggaataactgtgaacggggatctggatcagtacaccagtgaggactttgacaaaatattcagcgttaatgttaaagcgccgacttatctaaccaagcttgctaagcctcatctcagcaaaactaaaggtaatatcgtcaacatgtgtagcgtggtgagagaatgtcatataaagaattgtcttctgtatggaatggctaaagcatccctggcttatttaactaaaagtacagccgctgatttcgctgagaacggaataagatgcaatgccgttagcccaggatgtatttacggtacagatatactcaaaggaattctatctgatgagtttaaacaacaatactttgattcgtgcataacaaaactacgaggtcgtctggcaaccaagagtgatgtttcagacctcataaggttccttgcttcagataaggcgaccatgatcaccggagaaataatcactattgacggaggaaaggtgctttccctgaaaagttaagaaaccaagcgcgatttaaatgaatacaacgatttaaaattta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]