LOCUS       XM_018813081            1104 bp    mRNA    linear   INV 22-OCT-2018
DEFINITION  PREDICTED: Ciona intestinalis uncharacterized oxidoreductase
            TM_0325-like (LOC100186091), mRNA.
ACCESSION   XM_018813081
VERSION     XM_018813081.2
DBLINK      BioProject: PRJNA187185
KEYWORDS    RefSeq.
SOURCE      Ciona intestinalis (vase tunicate)
  ORGANISM  Ciona intestinalis
            Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Phlebobranchia;
            Cionidae; Ciona.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_020173.2) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 22, 2018 this sequence version replaced XM_018813081.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Ciona intestinalis Annotation
                                           Release 104
            Annotation Version          :: 104
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1104
                     /organism="Ciona intestinalis"
                     /mol_type="mRNA"
                     /db_xref="taxon:7719"
                     /chromosome="8"
     gene            1..1104
                     /gene="LOC100186091"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 9 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:100186091"
     CDS             288..1061
                     /gene="LOC100186091"
                     /codon_start=1
                     /product="uncharacterized protein LOC100186091"
                     /protein_id="XP_018668626.1"
                     /db_xref="GeneID:100186091"
                     /translation="

MAATKRVVLITGSATGIGAETAKGFAKEGASLCITGLPSQKDELAEVAKVCKENGSPHVLEVAADLRKQEDMYLLMNETIKTFGQLDVLVNNAGITVNGDLDQYTSEDFDKIFSVNVKAPTYLTKLAKPHLSKTKGNIVNMCSVVRECHIKNCLLYGMAKASLAYLTKSTAADFAENGIRCNAVSPGCIYGTDILKGILSDEFKQQYFDSCITKLRGRLATKSDVSDLIRFLASDKATMITGEIITIDGGKVLSLKS"

     misc_feature    303..1037
                     /gene="LOC100186091"
                     /note="NAD(P)-dependent dehydrogenase, short-chain alcohol
                     dehydrogenase family [Lipid transport and metabolism];
                     Region: FabG; COG1028"
                     /db_xref="CDD:440651"
ORIGIN      

ttaaaggtgatataatgcgaaacgccaagaacgaagcaggggtatacgattcatcgcatcataagcaagtatagtctatatttcaattagggccgtgggctacacatacagaaatcgccctgtttacaatgcgatcatgaaagatacaagaatttgttccacgcaagagttatacgaagaaggagcggtgtagtcttgcccacaactaaatcgacgaactttgctattgtgcagtttgtctgtctggcatataacgacatttagctaacgtatatataaataataaaatggcagcaacaaaacgagttgttttgataacaggtagtgcgactggtataggtgccgaaactgctaaaggatttgcaaaggaaggagcctcattgtgcatcactgggttaccatcccagaaagatgaattggcagaagttgcgaaagtttgcaaagaaaatggatctccgcatgtattggaagtagcagctgatctaagaaaacaagaagatatgtatttgttgatgaatgaaacgatcaagacgtttggacaacttgatgtcttggttaacaacgcaggaataactgtgaacggggatctggatcagtacaccagtgaggactttgacaaaatattcagcgttaatgttaaagcgccgacttatctaaccaagcttgctaagcctcatctcagcaaaactaaaggtaatatcgtcaacatgtgtagcgtggtgagagaatgtcatataaagaattgtcttctgtatggaatggctaaagcatccctggcttatttaactaaaagtacagccgctgatttcgctgagaacggaataagatgcaatgccgttagcccaggatgtatttacggtacagatatactcaaaggaattctatctgatgagtttaaacaacaatactttgattcgtgcataacaaaactacgaggtcgtctggcaaccaagagtgatgtttcagacctcataaggttccttgcttcagataaggcgaccatgatcaccggagaaataatcactattgacggaggaaaggtgctttccctgaaaagttaagaaaccaagcgcgatttaaatgaatacaacgatttaaaattta

//