2025-07-11 08:00:54, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_002127486 992 bp mRNA linear INV 22-OCT-2018 DEFINITION PREDICTED: Ciona intestinalis uncharacterized oxidoreductase TM_0325-like (LOC100179031), mRNA. ACCESSION XM_002127486 VERSION XM_002127486.4 DBLINK BioProject: PRJNA187185 KEYWORDS RefSeq. SOURCE Ciona intestinalis (vase tunicate) ORGANISM Ciona intestinalis Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Phlebobranchia; Cionidae; Ciona. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_020173.2) annotated using gene prediction method: Gnomon, supported by EST evidence. Also see: Documentation of NCBI's Annotation Process On Oct 22, 2018 this sequence version replaced XM_002127486.3. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Ciona intestinalis Annotation Release 104 Annotation Version :: 104 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.1 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..992 /organism="Ciona intestinalis" /mol_type="mRNA" /db_xref="taxon:7719" /chromosome="8" gene 1..992 /gene="LOC100179031" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 ESTs, 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 4 samples with support for all annotated introns" /db_xref="GeneID:100179031" CDS 176..949 /gene="LOC100179031" /codon_start=1 /product="uncharacterized protein LOC100179031" /protein_id="XP_002127522.1" /db_xref="GeneID:100179031" /translation="
MDATKRVVLITGSATGIGAGTAKGFAKEGASLCITGLPSQKDELAEVAKVCKENGSPHVLEVAADLRKQEDMDLLMNETIKTFGQLDVLVNNAGIQVYGDIEQYTSEEFDNVFSVNVKAPIYLTKLAKPHLSKTKGNIVNLCSVVRNWYLPKFIVYGMSKAAIEYLTKTTAADFAEIGVRCNAACPGMVLETDILVNVLPEEVQQQFREDCSTKLRGRTTTKSEVSDLIGFLASDKATMITGELITIDGGKMLSLTA"
misc_feature 191..934 /gene="LOC100179031" /note="A large family of proteins that share a Rossmann-fold NAD(P)H/NAD(P)(+) binding (NADB) domain. The NADB domain is found in numerous dehydrogenases of metabolic pathways such as glycolysis, and many other redox enzymes. NAD binding involves numerous...; Region: Rossmann-fold NAD(P)(+)-binding proteins; cl21454" /db_xref="CDD:473865" misc_feature order(209..211,215..220,224..226,281..283,290..295, 449..457,596..604,641..643,653..655,731..742) /gene="LOC100179031" /note="NAD(P) binding site [chemical binding]; other site" /db_xref="CDD:187535" misc_feature order(521..523,602..604,641..643,653..655) /gene="LOC100179031" /note="active site" /db_xref="CDD:187535" ORIGIN
gcaccactattaacaggtttagtatccacaattataaaccatttcaaaccttctcatgcatccaaatgaacaaaatagatgagacatttatataccgcagactaagtgacatcatttattcaaatattgtcgttgttagttatggatttacattcgtgtgcagatactgtgtaagatggatgcaacgaaacgagttgtgcttataacaggcagtgcgactggtataggtgccggaactgctaaaggatttgcaaaggaaggagcgtcattgtgcatcactgggttaccatcccagaaagatgaattggcagaagttgcaaaagtttgcaaagaaaatggatctccgcatgtattggaagtagcagctgatctgagaaaacaagaagatatggatttgttgatgaatgaaacgatcaaaacgtttggacaacttgatgtcttggttaacaacgctggaattcaagtgtacggcgatatagagcagtacacaagtgaggagtttgacaatgtttttagcgtcaatgttaaagcgccgatttatctaaccaagcttgctaagcctcatctcagcaaaactaaaggcaacattgtcaacttatgcagtgtagtaagaaactggtatcttccaaagtttattgtttacgggatgtctaaagcggcaattgaatatctgacaaaaaccacggctgcagattttgccgagattggagtacgatgtaacgccgcatgccccggaatggttcttgaaactgacatattggttaacgttctgccagaggaggtccaacagcagtttcgggaagattgttcaaccaaattaaggggacgtacaacaaccaaaagtgaagtttcggatctcatagggttccttgcttcagataaggcgaccatgatcactggagagttgattactattgacggtggaaagatgctttcattaaccgcataatgctacattacgtgatttaaataaataaaacaattcaaacttt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]