LOCUS       XM_002127486             992 bp    mRNA    linear   INV 22-OCT-2018
DEFINITION  PREDICTED: Ciona intestinalis uncharacterized oxidoreductase
            TM_0325-like (LOC100179031), mRNA.
ACCESSION   XM_002127486
VERSION     XM_002127486.4
DBLINK      BioProject: PRJNA187185
KEYWORDS    RefSeq.
SOURCE      Ciona intestinalis (vase tunicate)
  ORGANISM  Ciona intestinalis
            Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Phlebobranchia;
            Cionidae; Ciona.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_020173.2) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 22, 2018 this sequence version replaced XM_002127486.3.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Ciona intestinalis Annotation
                                           Release 104
            Annotation Version          :: 104
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..992
                     /organism="Ciona intestinalis"
                     /mol_type="mRNA"
                     /db_xref="taxon:7719"
                     /chromosome="8"
     gene            1..992
                     /gene="LOC100179031"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 10 ESTs, 1 Protein, and 100%
                     coverage of the annotated genomic feature by RNAseq
                     alignments, including 4 samples with support for all
                     annotated introns"
                     /db_xref="GeneID:100179031"
     CDS             176..949
                     /gene="LOC100179031"
                     /codon_start=1
                     /product="uncharacterized protein LOC100179031"
                     /protein_id="XP_002127522.1"
                     /db_xref="GeneID:100179031"
                     /translation="

MDATKRVVLITGSATGIGAGTAKGFAKEGASLCITGLPSQKDELAEVAKVCKENGSPHVLEVAADLRKQEDMDLLMNETIKTFGQLDVLVNNAGIQVYGDIEQYTSEEFDNVFSVNVKAPIYLTKLAKPHLSKTKGNIVNLCSVVRNWYLPKFIVYGMSKAAIEYLTKTTAADFAEIGVRCNAACPGMVLETDILVNVLPEEVQQQFREDCSTKLRGRTTTKSEVSDLIGFLASDKATMITGELITIDGGKMLSLTA"

     misc_feature    191..934
                     /gene="LOC100179031"
                     /note="A large family of proteins that share a
                     Rossmann-fold NAD(P)H/NAD(P)(+) binding (NADB) domain. The
                     NADB domain is found in numerous dehydrogenases of
                     metabolic pathways such as glycolysis, and many other
                     redox enzymes. NAD binding involves numerous...; Region:
                     Rossmann-fold NAD(P)(+)-binding proteins; cl21454"
                     /db_xref="CDD:473865"
     misc_feature    order(209..211,215..220,224..226,281..283,290..295,
                     449..457,596..604,641..643,653..655,731..742)
                     /gene="LOC100179031"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(521..523,602..604,641..643,653..655)
                     /gene="LOC100179031"
                     /note="active site"
                     /db_xref="CDD:187535"
ORIGIN      

gcaccactattaacaggtttagtatccacaattataaaccatttcaaaccttctcatgcatccaaatgaacaaaatagatgagacatttatataccgcagactaagtgacatcatttattcaaatattgtcgttgttagttatggatttacattcgtgtgcagatactgtgtaagatggatgcaacgaaacgagttgtgcttataacaggcagtgcgactggtataggtgccggaactgctaaaggatttgcaaaggaaggagcgtcattgtgcatcactgggttaccatcccagaaagatgaattggcagaagttgcaaaagtttgcaaagaaaatggatctccgcatgtattggaagtagcagctgatctgagaaaacaagaagatatggatttgttgatgaatgaaacgatcaaaacgtttggacaacttgatgtcttggttaacaacgctggaattcaagtgtacggcgatatagagcagtacacaagtgaggagtttgacaatgtttttagcgtcaatgttaaagcgccgatttatctaaccaagcttgctaagcctcatctcagcaaaactaaaggcaacattgtcaacttatgcagtgtagtaagaaactggtatcttccaaagtttattgtttacgggatgtctaaagcggcaattgaatatctgacaaaaaccacggctgcagattttgccgagattggagtacgatgtaacgccgcatgccccggaatggttcttgaaactgacatattggttaacgttctgccagaggaggtccaacagcagtttcgggaagattgttcaaccaaattaaggggacgtacaacaaccaaaagtgaagtttcggatctcatagggttccttgcttcagataaggcgaccatgatcactggagagttgattactattgacggtggaaagatgctttcattaaccgcataatgctacattacgtgatttaaataaataaaacaattcaaacttt

//