GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-12-15 14:25:57, GGRNA.v2 : RefSeq release 232 (Sep, 2025)

LOCUS       XM_002127434             878 bp    mRNA    linear   INV 22-OCT-2018
DEFINITION  PREDICTED: Ciona intestinalis uncharacterized oxidoreductase
            TM_0325-like (LOC100175900), mRNA.
ACCESSION   XM_002127434
VERSION     XM_002127434.5
DBLINK      BioProject: PRJNA187185
KEYWORDS    RefSeq.
SOURCE      Ciona intestinalis (vase tunicate)
  ORGANISM  Ciona intestinalis
            Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Phlebobranchia;
            Cionidae; Ciona.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_020173.2) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 22, 2018 this sequence version replaced XM_002127434.4.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Ciona intestinalis Annotation
                                           Release 104
            Annotation Version          :: 104
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..878
                     /organism="Ciona intestinalis"
                     /mol_type="mRNA"
                     /db_xref="taxon:7719"
                     /chromosome="8"
     gene            1..878
                     /gene="LOC100175900"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 9 ESTs, 2 Proteins, and 100%
                     coverage of the annotated genomic feature by RNAseq
                     alignments, including 15 samples with support for all
                     annotated introns"
                     /db_xref="GeneID:100175900"
     CDS             56..829
                     /gene="LOC100175900"
                     /codon_start=1
                     /product="uncharacterized protein LOC100175900"
                     /protein_id="XP_002127470.1"
                     /db_xref="GeneID:100175900"
                     /translation="
MDATKRVVLITGSATGIGAGTAKGFAKEGASLCITGLPSQKDELAEVAKVCKENGSPHVLEVAADLRKQEDMDLLMNETIKTFGQLDVLINNAGIALYGDIEQYTSEEFDNVFSINVKAMMYLTKLAKPYLSRTKGNVVNLCSVVRNWYLPKFIVYGMSKAAIEYLTKTTAADFAEIGVRCNAACPGMVLETNLMNSVVPKEVQQHFREGCSTKLRGRTTTKSEVSDLIRFLASDKATMITGELITIDGGKMLSLTA"
     misc_feature    71..814
                     /gene="LOC100175900"
                     /note="A large family of proteins that share a
                     Rossmann-fold NAD(P)H/NAD(P)(+) binding (NADB) domain. The
                     NADB domain is found in numerous dehydrogenases of
                     metabolic pathways such as glycolysis, and many other
                     redox enzymes. NAD binding involves numerous...; Region:
                     Rossmann-fold NAD(P)(+)-binding proteins; cl21454"
                     /db_xref="CDD:473865"
     misc_feature    order(89..91,95..100,104..106,161..163,170..175,329..337,
                     476..484,521..523,533..535,611..622)
                     /gene="LOC100175900"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(401..403,482..484,521..523,533..535)
                     /gene="LOC100175900"
                     /note="active site"
                     /db_xref="CDD:187535"
ORIGIN      
caaatattgtcgttgttagttatgaatctacattcgtgtgcagatactgtgtaagatggatgcaacgaaacgagttgtgcttataacaggcagtgcgactggtataggtgccggaactgccaaaggatttgcaaaggaaggagcctcattgtgcatcactggattaccatcccagaaagatgaattggcagaagttgcaaaagtttgcaaagaaaatggatctccgcatgtattggaagtagcagctgatctaagaaaacaagaagatatggatttgttgatgaatgaaacgatcaagacgtttggacaacttgatgtcttaattaacaatgccggaattgcattgtatggcgatatagagcagtacacaagtgaggaatttgacaatgttttcagcatcaatgttaaagcaatgatgtatctaaccaagcttgctaagccatatctaagcagaactaaaggcaacgttgtcaacttatgcagtgtagtaagaaactggtatcttccaaagtttattgtttacgggatgtctaaagcggcaattgaatatctgacaaaaaccacggctgcagattttgccgagattggagtacgatgtaacgccgcatgccccggaatggttcttgaaactaacctaatgaatagtgttgtgccaaaggaagttcaacagcatttccgggaaggttgttcaaccaaattaagaggacgtacaacaactaaaagtgaagtctcagatctcataaggttccttgcttcagataaggcgaccatgatcactggagaattgattactattgacggtggaaagatgctttcattgaccgcgtgatttctaatactacgtaacgtgatatgaataaatgaaacatcaaactgta
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]