GGRNA ver.2 Help | Advanced search | English    旧バージョン

2024-04-25 16:26:19, GGRNA : RefSeq release 222 (Jan, 2024)




Caenorhabditis elegans Protein clarinet (cla-1), partial mRNA. (25584 bp)
position 1741
NM_001307220.4 - Caenorhabditis elegans - NCBI - UCSC - WormBase
Caenorhabditis elegans Protein clarinet (cla-1), partial mRNA. (27002 bp)
position 1741
NM_001307219.4 - Caenorhabditis elegans - NCBI - UCSC - WormBase
PREDICTED: Dioscorea cayenensis subsp. rotundata uncharacterized LOC120275457 (LOC120275457), ncRNA. (148 bp)
samples with support for all annotated introns" /db_xref="GeneID:120275457" ncRNA 1..148 /ncRNA_class="lncRNA" /gene="LOC120275457" /product="uncharacterized LOC120275457" /db_xref="GeneID:120275457" ORIGIN // tgaaacccaaatcatgttttatgtttatggttgtagtaatgttcttcgtcatgtataagttgacaaaattccaacaggcacaagaagagattgaatcagtatctcagacttttgattccatgatgaggaggacaccaaagaagctgta
position 81
XR_005541109.1 - Dioscorea cayenensis subsp. rotundata (Guinea yam) - NCBI
PREDICTED: Pantherophis guttatus uncharacterized LOC132711909 (LOC132711909), ncRNA. (112 bp)
using gene prediction method: Gnomon." /db_xref="GeneID:132711909" ncRNA 1..112 /ncRNA_class="lncRNA" /gene="LOC132711909" /product="uncharacterized LOC132711909" /db_xref="GeneID:132711909" ORIGIN // caactctaatggctctccagtacacatctggaactgctggatggcctcgtggtgagacctcttatacccagggggaggagtcagaggcaagaagagattgcaccaatgaggg
position 88
XR_009622629.1 - Pantherophis guttatus - NCBI
Caenorhabditis elegans Unclassified non-coding RNA ZK1193.9 (ZK1193.9), ncRNA. (133 bp)
AUTHORS Sulson,J.E. and Waterston,R. TITLE Direct Submission JOURNAL Submitted (03-MAR-2003) Nematode Sequencing Project: Sanger Institute, Hinxton, Cambridge CB10 1SA, UK and The Genome Institute at Washington University, St. Louis, MO 63110, USA gaaggcgaccacgtcgtcgccaagaagagattgaagacgacgaatggagcgaaagtagtaaggaggggttgagggggggggaggtcgggatcgagatggcataatgtaggaaccggatggaagagtctaaaag
position 21
NR_070329.1 - Caenorhabditis elegans - NCBI - UCSC - WormBase
PREDICTED: Gossypium hirsutum calcium load-activated calcium channel (LOC107891247), mRNA. (1188 bp)
misc_feature 420..899 /gene="LOC107891247" /note="Integral membrane protein DUF106; Region: DUF106; pfam01956" /db_xref="CDD:396507" ORIGIN // gggattataggaggtgtgtttttctgggaacatatctttggagttgaatgctaacaagaagagattgaagttagtctatttaagttgaatgctaacaagaagagattgaagttagtctatttaagtgaatgcttcaagttgaactccgcaaattgtgaaagaaagaggtttcttgagttcatccttttcatttgtaggttgtatcgtttaataatagagataagagatgggttgaaatgagtaagcccatagtggtgagaaataaaaggcaaagcccactccttgggttgtcgtctacttgggattcgaatcaatttgactaggaacggatcacagagactgagagtgaagacacccacccaatcaaccttgtgaaaatggcgacaccccaattcctatcatccttccagtactccgacagtctaacagtcgtagctatctccttttgcactgccat...
position 55
XM_016815976.2 - Gossypium hirsutum (cotton) - NCBI
PREDICTED: Pseudonaja textilis uncharacterized LOC113437314 (LOC113437314), ncRNA. (153 bp)
including 1 sample with support for all annotated introns" /db_xref="GeneID:113437314" ncRNA 1..153 /ncRNA_class="lncRNA" /gene="LOC113437314" /product="uncharacterized LOC113437314" /db_xref="GeneID:113437314" ORIGIN // acaatcatccaatggaacagcttgccatcagaagctgtgagtacttcatcacttgagactttcaagaagagattggactgtcatttttcagaaatggtgtaggtctcctgcttgggcaggggtttggactagattacctacaaggtcttttcc
position 63
XR_003374214.1 - Pseudonaja textilis - NCBI
PREDICTED: Helianthus annuus uncharacterized LOC110938512 (LOC110938512), ncRNA. (219 bp)
ncRNA 1..219 /ncRNA_class="lncRNA" /gene="LOC110938512" /product="uncharacterized LOC110938512" /db_xref="GeneID:110938512" ORIGIN // ctcaagtacggcgtgcaacaagtgcctacccacgtcgtcaaagaactcatcatgcacgaggtggtgcttgggggtggccaggatgcatctgctgttaccacaaccatcatcgtgcggggaagtttgaagccaaattttatgacaaggttctgcaagaagagattggaggcgttaaaggacatttcgggccaattaatgctttggcattcaacccggatg
position 153
XR_002591448.2 - Helianthus annuus (common sunflower) - NCBI
Rhizoctonia solani ribosomal protein S30 (RhiXN_09607), partial mRNA. (192 bp)
AUTHORS Li,C. and Chen,X. TITLE Direct Submission JOURNAL Submitted (18-MAY-2020) Department of Plant Pathology, China Agricultural University, Yuanmingyuan Xilu 2, Beijing 100193, China atgggaaaagtccacggctcgctcgcccgcgcaggcaaagtcaaatctcaaactcccaaagtggagaaacaggagaagaagaagactcctaaaggtcgtgccaagaagagattgttgtacactcgtcgtttcgtgaatgttacgacgcttccaggcggaaagaggcgcatgaaccccaaccccgagaagtaa
position 102
XM_043329423.1 - Rhizoctonia solani - NCBI
PREDICTED: Physeter catodon non-histone chromosomal protein HMG-14-like (LOC102973125), mRNA. (255 bp)
codon_start=1 /product="non-histone chromosomal protein HMG-14-like" /protein_id="XP_054936220.1" /db_xref="GeneID:102973125" /translation="MPKKKVSSAEGAVKEEPKKRLARLSAKPAPAKVETKPKKAAGKDTSSDKKCKPKGKGGAKAKQAEMANQATKEDLPAENGETKN" ORIGIN // atgcccaagaagaaggtcagctccgctgagggggcagtgaaggaggagcccaagaagagattggcaaggttgtcagctaaaccggctcctgcaaaagtggaaacgaagccaaaaaaggcagcaggaaaggatacatcttcagacaaaaagtgcaaaccaaagggaaaagggggagcaaaggcaaaacaggctgaaatggctaaccaagcgactaaagaagacttacctgcagaaaatggagaaactaaaaactag
position 51
XM_055080245.1 - Physeter catodon (sperm whale) - NCBI
Polysphondylium pallidum PN500 40S ribosomal protein S30 (rps30-2), partial mRNA. (198 bp)
G., Schaap,P., Noegel,A.A., Felder,M. and Platzer,M. TITLE Direct Submission JOURNAL Submitted (11-DEC-2009) Genome Analysis, Fritz Lipmann Institute, Beutenbergstr. 11, Jena 07745, Germany atgggtaaggttcacggtggtttgaacagagctggtaaagtcagaaacgctactccaaacgttgagaagaaggaggtcagaaagccaaaggttggtcgtgccaagaagagattgttgtacaaccgtcgtttcgtcaacgttgtcgttggtttcggaaagaagaagggttacaacactcaaaacgtcccaaatgtctaa
position 102
XM_020573799.1 - Heterostelium album PN500 - NCBI
PREDICTED: Cricetulus griseus uncharacterized LOC103163642 (LOC103163642), ncRNA. (277 bp)
product="uncharacterized LOC103163642" /db_xref="GeneID:103163642" ORIGIN // tatagactgctgcatgctggctggctaggttgctctttttaacttagaaagttgaggaaacaacaaagtagaggatgaatggtatctggaggttgacatactgatactcggggaaggtacagatgtgaatttcagcatgaagaaaggaagatattttctgttgttcaaggatgagacataccatatgagagggagccactataggtccaagaagagattgggaccatggagatttccagagacctacaaggatgacatgatctcataatcaaggcaa
position 208
XR_003480888.2 - Cricetulus griseus (Chinese hamster) - NCBI
Caenorhabditis remanei uncharacterized protein (GCK72_025216), partial mRNA. (285 bp)
A.A., Willis,J.H. and Phillips,P.C. TITLE Direct Submission JOURNAL Submitted (19-DEC-2019) Institute of Ecology and Evolution, University of Oregon, 5289 University of Oregon, Eugene, OR 97403, USA atgtccggcaataaaagtgaaacgacagaaagtggaaaaactacgttgccgcatgaacgactgattgaagcatacaaccgaaggtttgaaattcaagaagagattgatgttatgaccaaaactacggatggctaccaatccaggaaatttgaccaattgacaatgcagctcacctatgttgacaatatcatctcaattggggagagcgactttgataagaaacgtgccgccaccgtgggaaagttgttcgctgtattgaggactctccaacattctaacaactaa
position 94
XM_053736243.1 - Caenorhabditis remanei - NCBI
[Candida] auris 60S_ribosomal_protein_L36 (CJI96_0003372), partial mRNA. (300 bp)
Broad Institute of MIT and Harvard, 415 Main Street, Cambridge, MA 02142, USA atggctagatctggtattgctgtcggtttgaacaagggccacaaggtcaacgctaaggaggttgctccaaagatctcccagagaaagggcgccctttcccagagaaccaagttcgtcagaagcattgtgtctgaggtttccggcttggctccatacgagagaagattgatcgagttgatcagaaacgccggtgagaagagagccaagaagttggccaagaagagattgggtactcacaagagagctctcagaaaggttgaggagatgaaccagatcattgctgagtccagaagacactaa
position 216
XM_029032793.1 - [Candida] auris - NCBI
Candida theae rpl36 (KGF57_004121), partial mRNA. (300 bp)
Supercomputing Center, Carrer Jordi Girona 29, Barcelona 08034, Spain atggctaagtcaggaattgcagtaggtttaaacaaaggccacaaggttgccaccaaggaagttgccccaaagatttcgtacagaaagggtgccttgtcacaaagaaccacttttgttagatcaatcgttaaagaagttgccggattggctccatacgaaagaagattgattgaattgattagaaatgccggtgagaagagggctaagaagttggccaagaagagattgggtactcacaagagagccggaaagaaggttgaagaaatgaacaagatcattgctgaatcaagaagacactaa
position 216
XM_051753611.1 - Candida theae - NCBI
PREDICTED: Nerophis lumbriciformis small VCP interacting protein (svip), mRNA. (243 bp)
GeneID:133603655" /translation="MGMCLPCFGGAVDDAVDTPDPETRRRQLAEAAEKRQKETAHRGVKNPEAVERKRKKQEEIEKQTMSTSVSSGGGLRWQVG" ORIGIN // atggggatgtgcctaccgtgctttggtggggcagtcgacgacgctgttgacactccagatccagagacgaggaggcgacagttagccgaggctgcagaaaaaagacaaaaagagacagcacacaggggtgttaaaaacccagaagcggttgaaaggaaaagaaaaaagcaagaagagattgaaaaacagacgatgagtacatctgtgtctagtggtggcgggttgaggtggcaggtgggctga
position 169
XM_061956917.1 - Nerophis lumbriciformis (worm pipefish) - NCBI
Komagataella phaffii GS115 60S ribosomal protein L36 (PAS_FragB_0036), partial mRNA. (306 bp)
/ Gent University, Technologiepark 927, Ghent, 9052, BELGIUM atgagaaatattgtactaacaaattcaggtattgcagtaggtgctaacaagggacacaaggtcaccccaaaggccgttgctccacaaaagagagtcgctatcagccaaagaactgactttgttagaaagttggtccgtgaggtcactggtctgtctccatacgaaagaagaatcattgagttgatcagaaactctggtgagaagagagccagaaagttcgccaagaagagattgggtactcacaccagagctaaggctaagttggaagagatgcaaaacgttatccaggaagcaaagcgtcattaa
position 222
XM_002490801.1 - Komagataella phaffii GS115 - NCBI
PREDICTED: Trematomus bernacchii all-trans-retinol 13,14-reductase-like (LOC117496684), mRNA. (1486 bp)
position 370
XM_034148409.1 - Trematomus bernacchii (emerald rockcod) - NCBI
Saccharomyces eubayanus RPL36B-like protein (DI49_5219), partial mRNA. (246 bp)
of Genetics, University of Wisconsin-Madison, 425-G Henry Mall, 2434 Genetics/Biotechnology Center, Madison, WI 53706-1580, USA atgactccagctccaaagatctcctacaagaagggtgctgcctccaacagaaccaagttcgtcagatctttggtcagagaaatcgctggtttgtctccatacgaaagaagattgatcgatttgatcagaaactccggtgaaaagagagccagaaaggtcgccaagaagagattgggttctttcatcagagccaaggctaaggtcgaggaaatgaacaacatcatcgctgcttctcgtcgtcattaa
position 162
XM_018368212.1 - Saccharomyces eubayanus - NCBI
Penicillium coprophilum Ankyrin and HET domain protein (N7500_004370), partial mRNA. (261 bp)
Bajers Vej 7H, Aalborg, Nordjylland 9220, Denmark atgatgaatgaaccgacgaatatcagtcgtccagtactctttcgagctcgggaaggtcttccaggcaaaggcaccaagaatcgtgcaggaaaaggcgatgaggtgtggctcattgctggaatgccgaccccagttgtgttgcgaaagacagagcgtgaggattgtttcacaagaactgatattgtctatgttcacgggatcatgcatggagaattgtttgaccagaaagatcgtatacaagaagagattgagctcatctag
position 238
XM_056675516.1 - Penicillium coprophilum - NCBI
Diutina rugosa uncharacterized protein (DIURU_003940), partial mRNA. (300 bp)
for Genomic Regulation, Carrer Dr. Aiguader, 88, 5, Barcelona 08003, Spain atggctaagtctggtattgctgttggtctcaacaagggtcacaagactaccgctaaggaagtcgcccccaagatctcgtacagaaagggtgccctcaccaagagaaccgagttcgtcagatcgatcgtgtcggaagtcgccgggttggctccttacgaaagaagattgatcgaattgatcagaaacgccggtgaaaagagagccaagaagttggccaagaagagattgggtacccacaagagagccttgaagaaggttgaagagatgaacggtgtcatcgctgcttccagaaagcactaa
position 216
XM_034156758.1 - Diutina rugosa - NCBI
[Candida] duobushaemulonis 60S ribosomal protein L36 (CXQ87_004317), partial mRNA. (300 bp)
for Disease Control and Prevention, 1600 Clifton Road, Atlanta, GA 30329, USA atggctagatctggtattgctgtcggtttgaacaagggccacaaggtcaacggtaaggaggttgctccaagaatctcccagagaaagggtgctctttcccagagaaccaagttcgtcagaagcattgtctctgaggtctccggtttggctccatacgagagaagattgattgaattgatcagaaacgccggtgagaagagagccaagaagttggccaagaagagattgggtactcacaagagagctctgagaaaggtcgaggagatgagtcagatcatcactgagtccagaagacactaa
position 216
XM_025482761.1 - [Candida] duobushaemulonis - NCBI
Saccharomyces paradoxus Gyp5 (SPAR_P00270), partial mRNA. (303 bp)
and Aging, Nice (IRCAN), 28 Avenue de Valombrose, Nice, PACA 06107, France atggctgtcaagactggtatcgctattggtttgaacaagggtaagaaagtcacccaaatgactccagctccaaagatctcctacaagaagggtgctgcctctaacagaaccaagttcgtcagatctttggttagagaaatcgccggtttgtccccatacgaaagaagattgatcgatttgatcagaaactccggtgaaaagagagccagaaaggtcgccaagaagagattgggttctttcaccagagccaaggctaaggtcgaagaaatgaacaacatcattgctgcctctcgtcgtcattaa
position 219
XM_033913633.1 - Saccharomyces paradoxus - NCBI
Penicillium chrysogenum uncharacterized protein (N7489_003630), partial mRNA. (270 bp)
NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 270) AUTHORS Petersen,C. TITLE Direct Submission JOURNAL Submitted (01-DEC-2022) Department of Chemistry and Bioscience, Aalborg University, Fredrik Bajers Vej 7H, Aalborg, Nordjylland 9220, Denmark atgggtccaatggcacacaaccagaagctgcaagaagagattgttgtgactagtttgactttgtcctaccaaatggcggtacggaccggtactatcctcaatttggctggggccctcattgctcgtcccggacatgagcctaaggctggcagctcggccgccaggactgttcctttctcttcctctcgggaatccactgcgattgggcaaccacaggctgaggcttctgaacagcctgctaatggaactcaacctcaatcggctatctaa
position 31
XM_056709385.1 - Penicillium chrysogenum - NCBI
Candida theae ATP14 (KGF57_002550), partial mRNA. (333 bp)
V. and Gabaldon,T. TITLE Direct Submission JOURNAL Submitted (08-JUL-2021) Life Sciences, Barcelona Supercomputing Center, Carrer Jordi Girona 29, Barcelona 08034, Spain atgttcagaccaattgctcgtatatcatcaagaagattattttcaatcaccccaagaagatcaaacttgattggtgacttgtacgtccaaaacattagacagttcaagccacaagccctttcacaagaagagattgatgccgctgtaaaaaagtttcaattgccaggtaagccaaccattccccaaatccacgagttgtcaactgaacaagttaaagagtatgaacagagtgaagttgaagctgaagctgcacaaccaactgaaaatgactctgaaactaagccagatgaagattggtttgtttttgatgaagttgaggctgagggccattaa
position 124
XM_051751876.1 - Candida theae - NCBI
Candida parapsilosis uncharacterized protein (CPAR2_104710), partial mRNA. (333 bp)
Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 333) AUTHORS Guida,A. TITLE Direct Submission JOURNAL Submitted (19-OCT-2011) to the INSDC atgttcagaccaattgcccgtatatcatcaagaagattgttttcaatcactcctagaagatcaaacttgattggagacttgtatgtccaaaacattagacaattcaaaccacaagccctttcacaagaagagattgattccgcagttaagaagtttcaattaccaggtaaaccaaccattccacaaattcacgaattgtcaactgaacaagttaaagagtatgagcaaaatgaagttgaagctgaggctgcacaaccaactgaagctaattctgaaactaaaccagatgaagattggtttgtttttgatgaagttgaagctgaaggacattag
position 124
XM_036812515.1 - Candida parapsilosis - NCBI
Metarhizium robertsii ARSEF 23 Fungal transcriptional regulatory protein (MAA_11608), partial mRNA. (273 bp)
Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, 300 Fenglin Road, Shanghai, Shanghai 200032, China atgattgctctcaagtcgtggaaaaagtctgaacgggtccgctgggacggaaataagcatagtcctgaggagacggctggcttgtttggtctcggtgccctttcatggcttaacccgctctcgttggcaggatacaagaagagattggccctagaggacttgtaccgcctcgattgcaacttggcatcagagcatctgcaggtcaatcacccgcctgtgtcaacagtctgcgcagtagccctgggaaacgttacggtctggccagagcgctga
position 135
XM_011412523.1 - Metarhizium robertsii ARSEF 23 - NCBI
PREDICTED: Papaver somniferum uncharacterized LOC113332400 (LOC113332400), ncRNA. (267 bp)
LOC113332400" /product="uncharacterized LOC113332400" /db_xref="GeneID:113332400" ORIGIN // gaagaagctggcagcactgaaaccagagaatagcactgtcaatgagtgggaagagttcgtgaaacatgtttgctcggaggaattcagaacaaaaagattctggatgcaacaaatcaggaagaaatacaccactccacacactatcagtagactgggttgggtgagactcgaggctaagatgcaaaaggaacggaaaacacaagaagagattgatagagtcgaagtttggacaacgggtcacaaacataaggaaggaaaggaacctaa
position 200
XR_003351493.1 - Papaver somniferum (opium poppy) - NCBI
Kuraishia capsulata CBS 1993 uncharacterized protein (KUCA_T00004322001), partial mRNA. (318 bp)
position 234
XM_022601045.1 - Kuraishia capsulata CBS 1993 - NCBI
PREDICTED: Fukomys damarensis uncharacterized LOC117283624 (LOC117283624), ncRNA. (322 bp)
by RNAseq alignments, including 2 samples with support for all annotated introns" /db_xref="GeneID:117283624" ncRNA 1..322 /ncRNA_class="lncRNA" /gene="LOC117283624" /product="uncharacterized LOC117283624" /db_xref="GeneID:117283624" ORIGIN // ctgataatggatctgagaagacttctagactccagtgtcaggctgtcttcaagaagagattgagagacccctgatttcgggaacgtacatacaacatgaagttgggccaccctttaactgactatggatcttacaactatatctgcaaagtggaggagcttgaacagtcttctgtaagcttttctggatgtgctgttgatcgatcccacccacctggctcattcagcatgagagaggtgatgaaatggatggaagaaaaccaccagcctgcccatgtgaaaatatgagaactgggaattcattttggaatattgttggagtc
position 50
XR_004514658.1 - Fukomys damarensis (Damara mole-rat) - NCBI
PREDICTED: Tripterygium wilfordii uncharacterized LOC119996202 (LOC119996202), mRNA. (351 bp)
Plant transposase (Ptta/En/Spm family); Region: Transposase_24; pfam03004" /db_xref="CDD:367291" ORIGIN // atgcaaagggttcgaaaaagggaggatgatggtgaatggattcaagaggaagccaaagttgcgcttgaaaagctttgggtggaaccggattatgtgaagaaaagggataaggcaatgatgaaccgagcatccgagactggcgggtgcactaatactggtggctctattccacactcggaacacaagaagagattgaatgattacaacaagctgaaggaagcctgttctagtcaagcatcgacctctggagagtcacctcttgaaccgcaggatgatgattccatattcatggaggtgactaagtgggtcaataagaaaggtcgtgtctacggtcttggatcaaaggcgtga
position 183
XM_038842755.1 - Tripterygium wilfordii - NCBI
Exophiala aquamarina CBS 119918 uncharacterized protein (A1O9_04897), partial mRNA. (288 bp)
Cambridge, MA 02142, USA atgccagacaatccacagtttcttggaccactactcccgcaacacattgccgaaaccatcaacgtcagcattggacccagtggcgagaacagggagtatctcttgcatctccaagatgccctagaagctctgagtgctcacagccatgacgaacatattgccgatctagcacgaagagtgcgtgctttggatccacctacgcggccggcatgtccttcttcaatcggccacgacttgaggaagattaacagcaccgaagaacaagaagagattgagaaggatacatga
position 262
XM_013407183.1 - Exophiala aquamarina CBS 119918 - NCBI
Acytostelium subglobosum LB1 hypothetical protein partial mRNA. (297 bp)
Acytostelium Genome Consortium TITLE Direct Submission JOURNAL Submitted (05-SEP-2014) Contact:Hideko Urushihara University of Tsukuba, Faculty of Life and Environmental Sciences; Tennodai 1-1-1, Tsukuba, Ibaraki 305-8572, Japan ggtcagaaacgctactccaaacgtggagaagaaggagacccgcaagtccaaggttggtcgtgccaagaagagattgttgtacaaccgtcgtttcgtcaacgttgtcaccggtttcggaaagaagaagggatacaacacccagaacgttccaaatgtctaagcaacatagtagcgtcgcgtccgtccctcagtagtcccgtgcctctccgctcattgcaacactggacactcgatcacggaggccagtcggtcctcaacagcccgtctgtcctccacgtaaataaacaaccggctttc
position 64
XM_012897535.1 - Acytostelium subglobosum LB1 - NCBI
Saccharomyces cerevisiae S288C ribosomal 60S subunit protein L36B (RPL36B), partial mRNA. (303 bp)
Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA atggctgtcaagactggtatcgctattggtttgaacaagggtaagaaagtcacccaaatgactccagccccaaagatctcctacaagaagggtgctgcctccaacagaaccaagttcgtcagatctttggttagagaaatcgccggtttgtccccatatgaaagaagattgatcgatttgatcagaaactccggtgaaaagagagccagaaaggtcgccaagaagagattgggttctttcaccagagccaaggctaaggtcgaagaaatgaacaacatcattgctgcctctcgtcgtcattaa
position 219
NM_001184312.1 - Saccharomyces cerevisiae S288C - NCBI
Saccharomyces cerevisiae S288C ribosomal 60S subunit protein L36A (RPL36A), partial mRNA. (303 bp)
Department of Genetics, Stanford University, Stanford, CA 94305-5120, USA atgaccgttaagacaggaattgctattggtttaaacaaaggtaagaaggtcactagcatgaccccagctccaaaaatctcttacaagaaaggtgctgcttccaacagaaccaagttcgtaagatctttggtcagagaaatcgctggtttgtctccatacgaaagaagattgattgatctaataagaaactctggtgaaaagagagctagaaaggtcgccaagaagagattgggttctttcaccagagccaaggctaaggtcgaagaaatgaacaacatcattgctgcttctcgtcgtcactaa
position 219
Synonym: RPL39B
NM_001182701.1 - Saccharomyces cerevisiae S288C - NCBI
Echinococcus granulosus hypothetical protein (EGR_02867), partial mRNA. (285 bp)
Key Laboratory of Health and Disease Genomics, Chinese National Human Genome Center at Shanghai, No. 250 Bibo Road, Shanghai 201203, China atgtcaatttatgtggagcaaatgaggtcaaaatacacgtatttacgaatacgtatgcaacgttctaattcggtttgtcgcagtacgacttcaaaaaccaagtggtatttgtccttttgtcactggatggcagttgtttatggcagagtgtcaagaagagattggttggattctaagcaccaaataaatcaagaacttgaggatgcattagcatcactagccaaaccacaatctccctcaggacaaatgagggcaataagcttgaagaatttaccttctctgtga
position 152
XM_024492116.1 - Echinococcus granulosus - NCBI
PREDICTED: Chiloscyllium plagiosum uncharacterized LOC122559481 (LOC122559481), ncRNA. (308 bp)
db_xref="GeneID:122559481" ORIGIN // tgatagaaacacagaattcaaagcactggagacaccatcctcactgtttaaagttttcaactggtgtttgtggattatatattatcggtactgaacatgtgtacaaacagctttatcatcatgatgcctgaccacaaaagactgagacatgatggaagaagtgacatcaaacaaaaagagccaaaggcccttaccatgcccttgcatcctccaagcaggcttctgccattagccaagaaagagattgttttggaacaagaagagattgattaacagttgtataccagccatgtcatgatttggaggtg
position 256
XR_006314432.1 - Chiloscyllium plagiosum (whitespotted bambooshark) - NCBI
Scheffersomyces stipitis CBS 6054 60S ribosomal protein L36 partial mRNA. (288 bp)
US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA 94598-1698, USA ggaattgctgttggattaaacaagggtcacaagactaccgctaaggaagttgctccaaagatctcttacagaaagggtgctctttccaagagaaccgacttcgtcagaaacatcgtcaaggaagttgctggcttagccccatacgaaagaagattgatcgaattgatcagaaacgccggtgaaaagagagctaagaagttggccaagaagagattgggtacccacaagagagccttgaagaaggttgaagaaatgaacaaggtcattgctgaaaccagaagacactaa
position 204
XM_001383429.1 - Scheffersomyces stipitis CBS 6054 (Pichia stipitis CBS 6054) - NCBI
Spathaspora passalidarum NRRL Y-27907 uncharacterized protein (SPAPADRAFT_55114), partial mRNA. (300 bp)
Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA 94598-1698, USA atggctaagtcaggtattgctgctggtttaaacaagggtcacaagactaccgctaaggaagtcgctccaaaggtttcctacagaaagggtgctttaagtaagagagctgactttgtcagaaacatcgtcaaggaagttgctggtttagccccatacgaaagaagattgattgaattgatcagaaacgccggtgaaaagagagctaagaagttggccaagaagagattgggtacccacaagagagctttaagaaaggttgaagaaatgaacaaggtcattgctgaatctagaagacactaa
position 216
XM_007374654.1 - Spathaspora passalidarum NRRL Y-27907 - NCBI
PREDICTED: Echeneis naucrates titin-like (LOC115036223), mRNA. (6594 bp)
position 2827
XM_029494347.1 - Echeneis naucrates (live sharksucker) - NCBI
Cantharellus anzutake uncharacterized protein (EI90DRAFT_3020538), partial mRNA. (378 bp)
Mitchell Drive, Walnut Creek, CA 94598-1698, USA atgatagacaacgaggtatccacttctccacacgcacctcctccattccacgattccgaaggtgatcccgtcccatcataccaacgcataaaccgaaacccagaaacgctcgccagatacctcttccgtttaggtttcatatttcccttcttctggatgctcgctgccaccatcattgttaccgacctcgttcctacttcatacactcccatcgctgggaaaagccccgaagagcaacaagaagagattgaagttcaccgtgccactgaactgaaatgggcatggagatcggtttatgcgttgggagggtggatcattttggccatcattatcttgggtatcatgcgtgccactcatactgggttcttcgcttcgtga
position 238
XM_039057512.1 - Cantharellus anzutake - NCBI
PREDICTED: Haliotis rubra uncharacterized LOC124281168 (LOC124281168), ncRNA. (343 bp)
lncRNA" /gene="LOC124281168" /product="uncharacterized LOC124281168" /db_xref="GeneID:124281168" ORIGIN // gtgcacatcaaggttttgaccaattctgcagaagacttgaaacgcttggcgtattaggagcgctaaaacatcatggaacacgcatgaaagaagtttttgtatatgaaaaaaggcttctggattctacaacaatagaactattgttcgagccagatttagcagaggccaactccaaccgacgccgccaagaagagattgttctctcaaactggagagattttcttcttgatttggaagaaggtacggaagtccccacactcaaagacctcttggtgtttgtgaccggggctgacggaatcccgcctctgggattcgacccctctccacacctgctgtttcactc
position 186
XR_006899862.1 - Haliotis rubra (blacklip abalone) - NCBI
[Candida] pseudohaemulonii 60S ribosomal protein L36 (C7M61_002398), partial mRNA. (300 bp)
Broad Institute of MIT and Harvard, 415 Main Street, Cambridge, MA 02142, USA atggctagatctggtattgctgtcggtttgaacaagggccacaaggtcaacgctaaggaggttgctccaagaatctcccagagaaagggtgctctttcccagagaaccaagttcgtcagaagcattgtctctgaggtctccggtttggctccatacgagagaagattgattgaattgatcagaaacgccggtgagaagagagccaagaagttggccaagaagagattgggtactcacaagagagctctcagaaaggtcgaggagatgaaccagatcatcactgagtccagaagacactaa
position 216
XM_024857773.1 - [Candida] pseudohaemulonii - NCBI
Metschnikowia bicuspidata var. bicuspidata NRRL YB-4993 ribosomal protein L36e (METBIDRAFT_76691), partial mRNA. (300 bp)
Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA 94598-1698, USA atggcccaaaccggtattgctgtcggtttgaacaagggtcacaaaaccacccaaaaggaagttgttccaagactttcccgcaagaagggagtcttgtccaagagagctgctttcgtcagaagcattgtctctgaggtctccggcttggccccatacgagagaagattgatcgagttgatcagaaacgccagcgagaagagagccaagaagttggccaagaagagattgggtacccacaagagagccttgagaaaggttgaggagatgaacaagatcattgctgagtctaagagacactaa
position 216
XM_018858572.1 - Metschnikowia bicuspidata var. bicuspidata NRRL YB-4993 - NCBI
Lachancea lanzarotensis LALA0S05e07514g1_1 (LALA0_S05e07514g), partial mRNA. (303 bp)
UMR 1319, Institut Micalis, Bat. CBAI, Thiverval-Grignon, 78850, France atggccgttaaatctggtatcgctactggtttgaacaagggtaagaaggtcaacgccatgaccccaaccccaaagatctcctacagaaagggtgcttcttccaacagaaccaagttcgtcagatctttggtcaaggaagttgccggtttggccccatacgaaagaagattgatcgatttgatcagaaacgctggtgaaaagagagccagaaaggtggccaagaagagattgggtaccttcggcagagccaaggccaaggtcgaggagatgaacgacatcatcaccgcttctcgtcgtcattaa
position 219
XM_022772423.1 - Lachancea lanzarotensis - NCBI
Saccharomyces eubayanus RPL36A-like protein (DI49_4277), partial mRNA. (303 bp)
Mall, 2434 Genetics/Biotechnology Center, Madison, WI 53706-1580, USA atggccgctaagacaggaatcgcaattggtttgaacaaaggtaagaaggtcactagcatgaccccagccccaaagatctcttacaagaagggtgctgcttccaacagaactaagttcgtcagatctttggttagagaaatcgccggtttgtctccatacgaaagaagattgatcgatctaataagaaactctggtgaaaagagagctagaaaggttgccaagaagagattgggttctttcatcagagccaaggctaaggttgaagaaatgaacaacattatttctgcttctcgtcgtcactaa
position 219
XM_018367307.1 - Saccharomyces eubayanus - NCBI
Kazachstania naganishii CBS 8797 hypothetical protein (KNAG0D00710), partial mRNA. (303 bp)
of Genetics, Trinity College Dublin, College Green, Dublin 2, IRELAND atggccgtcaagactggtattgctgttggtttgaacaagggtaagcaggtcaatgctatgaccccagccccaaagatgtcctacaagaagggtgccatctctaacagaacccagttcgtccgctcgctggtgaaggagatcgctggtctgtccccatacgaaagaagactgatcgacttgatcagaaactctggtgaaaagagagccagaaaggtcgccaagaagagattgggttctttcaagagagccaaggccaaggttgaggagatgaacaacgtcatcgctgcctctcgtcgtcattga
position 219
XM_022607478.1 - Kazachstania naganishii CBS 8797 - NCBI
[Candida] glabrata 60S ribosomal protein L36 (CAGL0K10906g), partial mRNA. (303 bp)
Paris Cedex 15, FRANCE. E-mail: atggccgttaagactggtattgctgttggtttgaacaagggtactaaggtcacccaaatgaccccagccccaaagatctcttacaagaagggtgctgcttctaacagaaccaagttcgttcgttctttggtcagagaaatcgctggtttgtctccatacgaaagaagattgatcgatttgatcagaaacgccggtgaaaagagagctagaaaggtcgccaagaagagattgggttctttcaccagagctaaggctaaggttgaagaaatgaactccatcattgctgcttctcgtcgtcactaa
position 219
XM_002999537.1 - Nakaseomyces glabratus (Candida glabrata) - NCBI
Eremothecium gossypii ATCC 10895 60S ribosomal protein L36 (AGOS_AFL163C), partial mRNA. (303 bp)
Biozentrum, Klingelbergstrasse 50, Basel CH-4056, Switzerland atggctgttaaatctggtattgctgttggtttgaacaagggtaagaaggtcaccccaatgacccctgctccaaaggtctcttacagaaagggtgcctcctccaagagaaccaccttcgtcagatctatcgtcagagaggttgccggcatggccccatacgagagaagattgatcgacttgatcagaaacgccggtgagaagagagccagaaaggtcgccaagaagagattgggcacctttggcagagctaaggctaaggttgaggaaatgaacgagatcattgctgcttctagacgtcactag
position 219
NM_210741.1 - Eremothecium gossypii ATCC 10895 (Ashbya gossypii ATCC 10895) - NCBI
Tetrapisispora blattae CBS 6284 hypothetical protein (TBLA0A02360), partial mRNA. (303 bp)
of Genetics, Trinity College Dublin, College Green, Dublin 2, IRELAND atggctgtcaaaactggtattgctgttggtttgaacaaaggtaagcaggtcgtctctatgaccccagctgccaagatctcatacaagaagggccaatcttctcaaagaaccaagttcgtcagatctttggtcagagaaatcgctggtttagctccatacgaaagaagattgatcgatttgatcagaaacgccggtgaaaagagagccagaaaggtcgccaagaagagattgggttctttcaccagagccaaggctaaggttgaagaaatgaacaacatcattgctgcctctcgtcgtcattag
position 219
XM_004177506.1 - Tetrapisispora blattae CBS 6284 - NCBI

Data Export:


Debug Info:

Redirect URI :
lang : ja | div : | spe : | query_string : caagaagagattg | format : html | download :

0.000 | 0.000 | search_start;
0.090 | 0.090 | count_done;
0.137 | 0.047 | search_done;,version,gi,length,symbol,synonym,geneid,division,source,definition&format=json
0.145 | 0.007 | cgi_end;

GGRNA ver.2 by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]