GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2024-09-28 13:19:51, GGRNA.v2 : RefSeq release 225 (Jul, 2024)

LOCUS       NM_001343639            1413 bp    mRNA    linear   PLN 20-OCT-2022
DEFINITION  Arabidopsis thaliana testis- and ovary-specific PAZ domain protein
            (AT5G20120), mRNA.
ACCESSION   NM_001343639
VERSION     NM_001343639.1
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 1413)
  AUTHORS   Tabata,S., Kaneko,T., Nakamura,Y., Kotani,H., Kato,T., Asamizu,E.,
            Miyajima,N., Sasamoto,S., Kimura,T., Hosouchi,T., Kawashima,K.,
            Kohara,M., Matsumoto,M., Matsuno,A., Muraki,A., Nakayama,S.,
            Nakazaki,N., Naruo,K., Okumura,S., Shinpo,S., Takeuchi,C., Wada,T.,
            Watanabe,A., Yamada,M., Yasuda,M., Sato,S., de la Bastide,M.,
            Huang,E., Spiegel,L., Gnoj,L., O'Shaughnessy,A., Preston,R.,
            Habermann,K., Murray,J., Johnson,D., Rohlfing,T., Nelson,J.,
            Stoneking,T., Pepin,K., Spieth,J., Sekhon,M., Armstrong,J.,
            Becker,M., Belter,E., Cordum,H., Cordes,M., Courtney,L.,
            Courtney,W., Dante,M., Du,H., Edwards,J., Fryman,J., Haakensen,B.,
            Lamar,E., Latreille,P., Leonard,S., Meyer,R., Mulvaney,E.,
            Ozersky,P., Riley,A., Strowmatt,C., Wagner-McPherson,C., Wollam,A.,
            Yoakum,M., Bell,M., Dedhia,N., Parnell,L., Shah,R., Rodriguez,M.,
            See,L.H., Vil,D., Baker,J., Kirchoff,K., Toth,K., King,L.,
            Bahret,A., Miller,B., Marra,M., Martienssen,R., McCombie,W.R.,
            Wilson,R.K., Murphy,G., Bancroft,I., Volckaert,G., Wambutt,R.,
            Dusterhoft,A., Stiekema,W., Pohl,T., Entian,K.D., Terryn,N.,
            Hartley,N., Bent,E., Johnson,S., Langham,S.A., McCullagh,B.,
            Robben,J., Grymonprez,B., Zimmermann,W., Ramsperger,U., Wedler,H.,
            Balke,K., Wedler,E., Peters,S., van Staveren,M., Dirkse,W.,
            Mooijman,P., Lankhorst,R.K., Weitzenegger,T., Bothe,G., Rose,M.,
            Hauf,J., Berneiser,S., Hempel,S., Feldpausch,M., Lamberth,S.,
            Villarroel,R., Gielen,J., Ardiles,W., Bents,O., Lemcke,K.,
            Kolesov,G., Mayer,K., Rudd,S., Schoof,H., Schueller,C.,
            Zaccaria,P., Mewes,H.W., Bevan,M. and Fransz,P.
  CONSRTM   Kazusa DNA Research Institute; Cold Spring Harbor and Washington
            University in St Louis Sequencing Consortium; European Union
            Arabidopsis Genome Sequencing Consortium
  TITLE     Sequence and analysis of chromosome 5 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 408 (6814), 823-826 (2000)
   PUBMED   11130714
REFERENCE   2  (bases 1 to 1413)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1413)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 1413)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            This record is derived from an annotated genomic sequence
            (NC_003076).
FEATURES             Location/Qualifiers
     source          1..1413
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="5"
                     /ecotype="Columbia"
     gene            1..1413
                     /locus_tag="AT5G20120"
                     /gene_synonym="F5O24.10; F5O24_10"
                     /db_xref="Araport:AT5G20120"
                     /db_xref="GeneID:832134"
                     /db_xref="TAIR:AT5G20120"
     CDS             524..1090
                     /locus_tag="AT5G20120"
                     /gene_synonym="F5O24.10; F5O24_10"
                     /codon_start=1
                     /product="testis- and ovary-specific PAZ domain protein"
                     /protein_id="NP_001331187.1"
                     /db_xref="GeneID:832134"
                     /db_xref="Araport:AT5G20120"
                     /db_xref="TAIR:AT5G20120"
                     /translation="
MSGGTPVGGGGYIRQRHSQGYASGGDDLEDDACSRPQPFSLENPRSKTWVEILENVLWIASAVFIVYFGDRHSNMIHILLRDARIKRMPLYFGMLGIAVNIIIIIYESMLSWSMRRFDEKWELWSISALPFITLLGIISFGLLSFALWPIWGFLTLPLLFTLFMACLVVFPHLMIIKFRPQNDELRID"
     misc_feature    662..979
                     /locus_tag="AT5G20120"
                     /gene_synonym="F5O24.10; F5O24_10"
                     /note="TMEM128 protein; Region: TMEM128; pfam20479"
                     /db_xref="CDD:466628"
ORIGIN      
aaaacgacgtcgtttcgttaaaatctgctttgaaaacggttcagttgccagactctctcaaaacgcttcagtctccaaggaacctaaaaaagcttcctttttgggacgaagtttcttagagaatttgtgattccgattcttagggttttcaccaagcgttccttcgcgacgagctctcaatttttgaggttattgatttcttcttctgatcgaattttccgtatctgctagtgaattcttctttctcagctcagggtttctcaattctccgttctcgatctcttgatacgatcgatctttcgaattgaatccatttgtcaatttttcgttgcagtctcgttggcggcgcaatcatcatagactttgggggatcgcttgtaatgagacgaatttcaaagtttggtatcttttacttgcctgaattgaccaattcgacttttatatagagacgtctattagggttttgtgttgctaaggaggtgggattattgtgtactagagggttcttttagcttctaggaacatgtctggtggaactccagttggtggtggtgggtacattaggcaaagacatagccaaggttatgcttctggtggtgatgatcttgaggatgatgcttgctctaggccacagcctttttctttagagaatcctagaagtaaaacctgggttgagattttggagaatgtgctttggattgcatctgctgtcttcattgtctattttggagacaggcactctaatatgatacatattctcttacgtgatgctcggatcaaaaggatgcctttgtatttcgggatgttgggaatagctgtgaacattataatcataatctacgaaagcatgttatcttggagcatgagaaggtttgatgagaaatgggaactgtggagtatctctgctctgcctttcatcaccctactcggcatcatttcatttggcctgctctcctttgctctgtggcctatatggggcttcttgactctcccccttctgttcacattgttcatggcatgccttgttgtgttcccacatctcatgatcatcaaattcaggcctcaaaacgacgaactccgcatagattgatctgtagagaatggagatagtgttattgggaacgttgaaacccttttgttattcagaagtcaataaatctgaaagtgaagggggaatttgttggtttgtggtatatagatagatgaactcattgatcaatagggatctttttttctctttactgtttttggtctctgagattggttcatgtcttgtttcgtttctgagttcagtgaagtgaaaaatattctcattcagtctccttcaaactctagttttcgacgaattcaatctgtagggtaaaacatttgtagtagagaaggctcataagctataagactacaacaagccta
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]