GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-09-18 10:25:51, GGRNA.v2 : RefSeq release 231 (Jul, 2025)

LOCUS       NM_001204036            1905 bp    mRNA    linear   PLN 20-OCT-2022
DEFINITION  Arabidopsis thaliana ubiquitin-specific protease 27 (UBP27), mRNA.
ACCESSION   NM_001204036
VERSION     NM_001204036.1
DBLINK      BioProject: PRJNA116
            BioSample: SAMN03081427
KEYWORDS    RefSeq.
SOURCE      Arabidopsis thaliana (thale cress)
  ORGANISM  Arabidopsis thaliana
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
            Camelineae; Arabidopsis.
REFERENCE   1  (bases 1 to 1905)
  AUTHORS   Mayer,K., Schuller,C., Wambutt,R., Murphy,G., Volckaert,G.,
            Pohl,T., Dusterhoft,A., Stiekema,W., Entian,K.D., Terryn,N.,
            Harris,B., Ansorge,W., Brandt,P., Grivell,L., Rieger,M.,
            Weichselgartner,M., de Simone,V., Obermaier,B., Mache,R.,
            Muller,M., Kreis,M., Delseny,M., Puigdomenech,P., Watson,M.,
            Schmidtheini,T., Reichert,B., Portatelle,D., Perez-Alonso,M.,
            Boutry,M., Bancroft,I., Vos,P., Hoheisel,J., Zimmermann,W.,
            Wedler,H., Ridley,P., Langham,S.A., McCullagh,B., Bilham,L.,
            Robben,J., Van der Schueren,J., Grymonprez,B., Chuang,Y.J.,
            Vandenbussche,F., Braeken,M., Weltjens,I., Voet,M., Bastiaens,I.,
            Aert,R., Defoor,E., Weitzenegger,T., Bothe,G., Ramsperger,U.,
            Hilbert,H., Braun,M., Holzer,E., Brandt,A., Peters,S., van
            Staveren,M., Dirske,W., Mooijman,P., Klein Lankhorst,R., Rose,M.,
            Hauf,J., Kotter,P., Berneiser,S., Hempel,S., Feldpausch,M.,
            Lamberth,S., Van den Daele,H., De Keyser,A., Buysshaert,C.,
            Gielen,J., Villarroel,R., De Clercq,R., Van Montagu,M., Rogers,J.,
            Cronin,A., Quail,M., Bray-Allen,S., Clark,L., Doggett,J., Hall,S.,
            Kay,M., Lennard,N., McLay,K., Mayes,R., Pettett,A.,
            Rajandream,M.A., Lyne,M., Benes,V., Rechmann,S., Borkova,D.,
            Blocker,H., Scharfe,M., Grimm,M., Lohnert,T.H., Dose,S., de
            Haan,M., Maarse,A., Schafer,M., Muller-Auer,S., Gabel,C., Fuchs,M.,
            Fartmann,B., Granderath,K., Dauner,D., Herzl,A., Neumann,S.,
            Argiriou,A., Vitale,D., Liguori,R., Piravandi,E., Massenet,O.,
            Quigley,F., Clabauld,G., Mundlein,A., Felber,R., Schnabl,S.,
            Hiller,R., Schmidt,W., Lecharny,A., Aubourg,S., Chefdor,F.,
            Cooke,R., Berger,C., Montfort,A., Casacuberta,E., Gibbons,T.,
            Weber,N., Vandenbol,M., Bargues,M., Terol,J., Torres,A.,
            Perez-Perez,A., Purnelle,B., Bent,E., Johnson,S., Tacon,D.,
            Jesse,T., Heijnen,L., Schwarz,S., Scholler,P., Heber,S., Francs,P.,
            Bielke,C., Frishman,D., Haase,D., Lemcke,K., Mewes,H.W.,
            Stocker,S., Zaccaria,P., Bevan,M., Wilson,R.K., de la Bastide,M.,
            Habermann,K., Parnell,L., Dedhia,N., Gnoj,L., Schutz,K., Huang,E.,
            Spiegel,L., Sehkon,M., Murray,J., Sheet,P., Cordes,M.,
            Abu-Threideh,J., Stoneking,T., Kalicki,J., Graves,T., Harmon,G.,
            Edwards,J., Latreille,P., Courtney,L., Cloud,J., Abbott,A.,
            Scott,K., Johnson,D., Minx,P., Bentley,D., Fulton,B., Miller,N.,
            Greco,T., Kemp,K., Kramer,J., Fulton,L., Mardis,E., Dante,M.,
            Pepin,K., Hillier,L., Nelson,J., Spieth,J., Ryan,E., Andrews,S.,
            Geisel,C., Layman,D., Du,H., Ali,J., Berghoff,A., Jones,K.,
            Drone,K., Cotton,M., Joshu,C., Antonoiu,B., Zidanic,M., Strong,C.,
            Sun,H., Lamar,B., Yordan,C., Ma,P., Zhong,J., Preston,R., Vil,D.,
            Shekher,M., Matero,A., Shah,R., Swaby,I.K., O'Shaughnessy,A.,
            Rodriguez,M., Hoffmann,J., Till,S., Granat,S., Shohdy,N.,
            Hasegawa,A., Hameed,A., Lodhi,M., Johnson,A., Chen,E., Marra,M.,
            Martienssen,R. and McCombie,W.R.
  TITLE     Sequence and analysis of chromosome 4 of the plant Arabidopsis
            thaliana
  JOURNAL   Nature 402 (6763), 769-777 (1999)
   PUBMED   10617198
REFERENCE   2  (bases 1 to 1905)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (19-OCT-2022) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1905)
  AUTHORS   Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
            Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
            Vaughn,M. and Town,C.D.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
            9704 Medical Center Dr, Rockville, MD 20850, USA
  REMARK    Protein update by submitter
REFERENCE   4  (bases 1 to 1905)
  AUTHORS   Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
  CONSRTM   TAIR
  TITLE     Direct Submission
  JOURNAL   Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
            Institution, 260 Panama Street, Stanford, CA, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
            This record is derived from an annotated genomic sequence
            (NC_003075).
FEATURES             Location/Qualifiers
     source          1..1905
                     /organism="Arabidopsis thaliana"
                     /mol_type="mRNA"
                     /db_xref="taxon:3702"
                     /chromosome="4"
                     /ecotype="Columbia"
     gene            1..1905
                     /gene="UBP27"
                     /locus_tag="AT4G39370"
                     /gene_synonym="F23K16.5; F23K16_5; ubiquitin-specific
                     protease 27"
                     /note="Encodes a ubiquitin-specific protease."
                     /db_xref="Araport:AT4G39370"
                     /db_xref="GeneID:830092"
                     /db_xref="TAIR:AT4G39370"
     CDS             258..1775
                     /gene="UBP27"
                     /locus_tag="AT4G39370"
                     /gene_synonym="F23K16.5; F23K16_5; ubiquitin-specific
                     protease 27"
                     /note="ubiquitin-specific protease 27 (UBP27); FUNCTIONS
                     IN: ubiquitin-specific protease activity, ubiquitin
                     thiolesterase activity; INVOLVED IN: ubiquitin-dependent
                     protein catabolic process; EXPRESSED IN: 19 plant
                     structures; EXPRESSED DURING: 12 growth stages; CONTAINS
                     InterPro DOMAIN/s: Peptidase C19, ubiquitin
                     carboxyl-terminal hydrolase 2, conserved site
                     (InterPro:IPR018200), Peptidase C19, ubiquitin
                     carboxyl-terminal hydrolase 2 (InterPro:IPR001394); BEST
                     Arabidopsis thaliana protein match is: ubiquitin-specific
                     protease 23 (TAIR:AT5G57990.1)."
                     /codon_start=1
                     /product="ubiquitin-specific protease 27"
                     /protein_id="NP_001190965.1"
                     /db_xref="GeneID:830092"
                     /db_xref="TAIR:AT4G39370"
                     /db_xref="Araport:AT4G39370"
                     /translation="
MVSRRGSETKAIVCVLTDRIRISNQWVSHLSFAGLLGVAGFVFAQQHGLFRNLNNLKLFSGREKDSGDDSFLVPGLQNLGNNCFLNVILQALASCKDFRSFLQWVLEDARGSLAGEQEEQLPLTFALSALLQELGTVGSRRSVSNPRKVMVTLTDYAKNFNLTSQQDAAEALLHLISSLQEEIVVCYRPSQSSNLSDILFSRNLRMLAPSEGLHGLMELKRWHKHLRGPFDGILGSTLMCRTCSSQISLEFQFFHTLPLSPLLHHGGYNIMSGCTLEHCLKKFLNTEKVENYFCYRCWHGAALKYLSVIGAAETEIEKLRSCGGEDQCDCKTSLHLQRMPWSNSYSHILKQLIIARFPKVFAYSLKLDVKLLCIQVQRASFNMFEEFKLSGHIAFPLVLNLSLFTPSSIGVNIEERIEMSSEYQKPEASKNHGMYRLVTVVEHFGRTGSGHYTVYRSVRVFSQEEEEEDCDEDLSWFSISDSEVCRVSESDVLGAEASLLFYERL"
     misc_feature    480..1766
                     /gene="UBP27"
                     /locus_tag="AT4G39370"
                     /gene_synonym="F23K16.5; F23K16_5; ubiquitin-specific
                     protease 27"
                     /note="A subfamily of Peptidase C19. Peptidase C19
                     contains ubiquitinyl hydrolases. They are intracellular
                     peptidases that remove ubiquitin molecules from
                     polyubiquinated peptides by cleavage of isopeptide bonds.
                     They hydrolyze bonds involving the carboxyl...; Region:
                     Peptidase_C19F; cd02662"
                     /db_xref="CDD:239127"
     misc_feature    <480..>1034
                     /gene="UBP27"
                     /locus_tag="AT4G39370"
                     /gene_synonym="F23K16.5; F23K16_5; ubiquitin-specific
                     protease 27"
                     /note="Ubiquitin C-terminal hydrolase [Posttranslational
                     modification, protein turnover, chaperones]; Region:
                     UBP12; COG5560"
                     /db_xref="CDD:227847"
     misc_feature    order(489..491,504..506,1608..1610,1698..1700)
                     /gene="UBP27"
                     /locus_tag="AT4G39370"
                     /gene_synonym="F23K16.5; F23K16_5; ubiquitin-specific
                     protease 27"
                     /note="active site"
                     /db_xref="CDD:239127"
ORIGIN      
aattctatgtttacaagttacaatagttaggaaattgtaatttcaaatcaaataagctaaaaagatgttattattaaaatgttcagacgaattaaaccggacctaatttgcttggtcttttggccgctgaccttgtctgattgatcgggatttttgtacggcgaatcaaaatccaccgaacaaaccggaaggctaggatgctcaagctttacggattgacttagagagagatcgatttgaactgtgtcattttgagcatggtttctagaagaggctccgagacaaaagcgattgtctgtgtcctcacggatagaattaggatctctaatcaatgggtttcgcatttgtctttcgctggtctacttggtgttgctggtttcgtatttgcccaacagcacggtctattccgcaacttaaacaacttaaaactcttctccggtagagaaaaagactccggagacgattcttttctcgtacctggccttcaaaatctcggaaataactgcttcctcaacgtcatcctccaggctctagcgagctgcaaagattttaggagttttcttcaatgggttctagaggatgcgagaggttcgttagcaggagaacaagaggaacagcttcctcttacttttgctttgtctgctttattacaagagctcggcacagttggaagtagacgatctgtatctaaccctcgtaaagttatggtgacattgactgactatgccaaaaatttcaatttgacaagccaacaggatgcagcagaagcccttcttcatcttatatcttctttgcaagaagagattgtagtttgttatcgccctagccaaagtagtaatctttcggatatacttttctctcgcaacttgagaatgcttgcgcctagtgaaggcctccatggtttgatggagctcaagagatggcataaacatttgcgtggaccatttgatgggattcttggtagtactttaatgtgccgaacttgttcatctcagatttctttggagtttcagttttttcatactctgcctctttctcctttactccatcacggtggttacaacattatgtctggatgcactttggagcattgcttgaagaagtttcttaacactgagaaagttgaaaactacttctgctatagatgctggcatggtgctgcactgaaatatttatctgtgataggagcagctgagacggaaatcgaaaagctcaggagctgtggcggagaggaccaatgtgactgtaaaacttctcttcatcttcaaagaatgccttggtcaaatagctattcccatatattgaaacagttaatcatcgcccgtttcccaaaggtatttgcttactcattgaaactagacgtgaaactcctatgcattcaagtgcaacgcgcttcgtttaacatgtttgaggaattcaaactgtcgggacatatcgcatttccacttgtcttgaacctctccttgttcacaccatcttcaataggcgtaaacatagaagaaaggattgagatgtcgtcagagtaccaaaagccagaagcatcaaaaaatcacggcatgtacaggcttgtaacagtagtggagcattttggtagaaccggaagcgggcattatactgtatacagaagtgtgagagtgttctcacaagaggaagaagaagaagattgtgatgaggatttgagctggtttagtatatctgattcagaagtttgcagagtttcagagagtgatgttcttggtgctgaagctagcttgctcttctatgaaaggctttgataaaagagaaattaatttagagcttggttttcattggattgatcgagtgttctaaggtttcttttctgcacttggagaaattagaagatacgtgagtggagttgtttttgaatatattttcgcctatagc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]