ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2025-12-24 11:59:58, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS NM_001204036 1905 bp mRNA linear PLN 20-OCT-2022
DEFINITION Arabidopsis thaliana ubiquitin-specific protease 27 (UBP27), mRNA.
ACCESSION NM_001204036
VERSION NM_001204036.1
DBLINK BioProject: PRJNA116
BioSample: SAMN03081427
KEYWORDS RefSeq.
SOURCE Arabidopsis thaliana (thale cress)
ORGANISM Arabidopsis thaliana
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
Pentapetalae; rosids; malvids; Brassicales; Brassicaceae;
Camelineae; Arabidopsis.
REFERENCE 1 (bases 1 to 1905)
AUTHORS Mayer,K., Schuller,C., Wambutt,R., Murphy,G., Volckaert,G.,
Pohl,T., Dusterhoft,A., Stiekema,W., Entian,K.D., Terryn,N.,
Harris,B., Ansorge,W., Brandt,P., Grivell,L., Rieger,M.,
Weichselgartner,M., de Simone,V., Obermaier,B., Mache,R.,
Muller,M., Kreis,M., Delseny,M., Puigdomenech,P., Watson,M.,
Schmidtheini,T., Reichert,B., Portatelle,D., Perez-Alonso,M.,
Boutry,M., Bancroft,I., Vos,P., Hoheisel,J., Zimmermann,W.,
Wedler,H., Ridley,P., Langham,S.A., McCullagh,B., Bilham,L.,
Robben,J., Van der Schueren,J., Grymonprez,B., Chuang,Y.J.,
Vandenbussche,F., Braeken,M., Weltjens,I., Voet,M., Bastiaens,I.,
Aert,R., Defoor,E., Weitzenegger,T., Bothe,G., Ramsperger,U.,
Hilbert,H., Braun,M., Holzer,E., Brandt,A., Peters,S., van
Staveren,M., Dirske,W., Mooijman,P., Klein Lankhorst,R., Rose,M.,
Hauf,J., Kotter,P., Berneiser,S., Hempel,S., Feldpausch,M.,
Lamberth,S., Van den Daele,H., De Keyser,A., Buysshaert,C.,
Gielen,J., Villarroel,R., De Clercq,R., Van Montagu,M., Rogers,J.,
Cronin,A., Quail,M., Bray-Allen,S., Clark,L., Doggett,J., Hall,S.,
Kay,M., Lennard,N., McLay,K., Mayes,R., Pettett,A.,
Rajandream,M.A., Lyne,M., Benes,V., Rechmann,S., Borkova,D.,
Blocker,H., Scharfe,M., Grimm,M., Lohnert,T.H., Dose,S., de
Haan,M., Maarse,A., Schafer,M., Muller-Auer,S., Gabel,C., Fuchs,M.,
Fartmann,B., Granderath,K., Dauner,D., Herzl,A., Neumann,S.,
Argiriou,A., Vitale,D., Liguori,R., Piravandi,E., Massenet,O.,
Quigley,F., Clabauld,G., Mundlein,A., Felber,R., Schnabl,S.,
Hiller,R., Schmidt,W., Lecharny,A., Aubourg,S., Chefdor,F.,
Cooke,R., Berger,C., Montfort,A., Casacuberta,E., Gibbons,T.,
Weber,N., Vandenbol,M., Bargues,M., Terol,J., Torres,A.,
Perez-Perez,A., Purnelle,B., Bent,E., Johnson,S., Tacon,D.,
Jesse,T., Heijnen,L., Schwarz,S., Scholler,P., Heber,S., Francs,P.,
Bielke,C., Frishman,D., Haase,D., Lemcke,K., Mewes,H.W.,
Stocker,S., Zaccaria,P., Bevan,M., Wilson,R.K., de la Bastide,M.,
Habermann,K., Parnell,L., Dedhia,N., Gnoj,L., Schutz,K., Huang,E.,
Spiegel,L., Sehkon,M., Murray,J., Sheet,P., Cordes,M.,
Abu-Threideh,J., Stoneking,T., Kalicki,J., Graves,T., Harmon,G.,
Edwards,J., Latreille,P., Courtney,L., Cloud,J., Abbott,A.,
Scott,K., Johnson,D., Minx,P., Bentley,D., Fulton,B., Miller,N.,
Greco,T., Kemp,K., Kramer,J., Fulton,L., Mardis,E., Dante,M.,
Pepin,K., Hillier,L., Nelson,J., Spieth,J., Ryan,E., Andrews,S.,
Geisel,C., Layman,D., Du,H., Ali,J., Berghoff,A., Jones,K.,
Drone,K., Cotton,M., Joshu,C., Antonoiu,B., Zidanic,M., Strong,C.,
Sun,H., Lamar,B., Yordan,C., Ma,P., Zhong,J., Preston,R., Vil,D.,
Shekher,M., Matero,A., Shah,R., Swaby,I.K., O'Shaughnessy,A.,
Rodriguez,M., Hoffmann,J., Till,S., Granat,S., Shohdy,N.,
Hasegawa,A., Hameed,A., Lodhi,M., Johnson,A., Chen,E., Marra,M.,
Martienssen,R. and McCombie,W.R.
TITLE Sequence and analysis of chromosome 4 of the plant Arabidopsis
thaliana
JOURNAL Nature 402 (6763), 769-777 (1999)
PUBMED 10617198
REFERENCE 2 (bases 1 to 1905)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (19-OCT-2022) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
REFERENCE 3 (bases 1 to 1905)
AUTHORS Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M.,
Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R.,
Vaughn,M. and Town,C.D.
TITLE Direct Submission
JOURNAL Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute,
9704 Medical Center Dr, Rockville, MD 20850, USA
REMARK Protein update by submitter
REFERENCE 4 (bases 1 to 1905)
AUTHORS Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E.
CONSRTM TAIR
TITLE Direct Submission
JOURNAL Submitted (18-FEB-2011) Department of Plant Biology, Carnegie
Institution, 260 Panama Street, Stanford, CA, USA
COMMENT REVIEWED REFSEQ: This record has been curated by TAIR and Araport.
This record is derived from an annotated genomic sequence
(NC_003075).
FEATURES Location/Qualifiers
source 1..1905
/organism="Arabidopsis thaliana"
/mol_type="mRNA"
/db_xref="taxon:3702"
/chromosome="4"
/ecotype="Columbia"
gene 1..1905
/gene="UBP27"
/locus_tag="AT4G39370"
/gene_synonym="F23K16.5; F23K16_5; ubiquitin-specific
protease 27"
/note="Encodes a ubiquitin-specific protease."
/db_xref="Araport:AT4G39370"
/db_xref="GeneID:830092"
/db_xref="TAIR:AT4G39370"
CDS 258..1775
/gene="UBP27"
/locus_tag="AT4G39370"
/gene_synonym="F23K16.5; F23K16_5; ubiquitin-specific
protease 27"
/note="ubiquitin-specific protease 27 (UBP27); FUNCTIONS
IN: ubiquitin-specific protease activity, ubiquitin
thiolesterase activity; INVOLVED IN: ubiquitin-dependent
protein catabolic process; EXPRESSED IN: 19 plant
structures; EXPRESSED DURING: 12 growth stages; CONTAINS
InterPro DOMAIN/s: Peptidase C19, ubiquitin
carboxyl-terminal hydrolase 2, conserved site
(InterPro:IPR018200), Peptidase C19, ubiquitin
carboxyl-terminal hydrolase 2 (InterPro:IPR001394); BEST
Arabidopsis thaliana protein match is: ubiquitin-specific
protease 23 (TAIR:AT5G57990.1)."
/codon_start=1
/product="ubiquitin-specific protease 27"
/protein_id="NP_001190965.1"
/db_xref="GeneID:830092"
/db_xref="TAIR:AT4G39370"
/db_xref="Araport:AT4G39370"
/translation="
MVSRRGSETKAIVCVLTDRIRISNQWVSHLSFAGLLGVAGFVFAQQHGLFRNLNNLKLFSGREKDSGDDSFLVPGLQNLGNNCFLNVILQALASCKDFRSFLQWVLEDARGSLAGEQEEQLPLTFALSALLQELGTVGSRRSVSNPRKVMVTLTDYAKNFNLTSQQDAAEALLHLISSLQEEIVVCYRPSQSSNLSDILFSRNLRMLAPSEGLHGLMELKRWHKHLRGPFDGILGSTLMCRTCSSQISLEFQFFHTLPLSPLLHHGGYNIMSGCTLEHCLKKFLNTEKVENYFCYRCWHGAALKYLSVIGAAETEIEKLRSCGGEDQCDCKTSLHLQRMPWSNSYSHILKQLIIARFPKVFAYSLKLDVKLLCIQVQRASFNMFEEFKLSGHIAFPLVLNLSLFTPSSIGVNIEERIEMSSEYQKPEASKNHGMYRLVTVVEHFGRTGSGHYTVYRSVRVFSQEEEEEDCDEDLSWFSISDSEVCRVSESDVLGAEASLLFYERL"
misc_feature 480..1766
/gene="UBP27"
/locus_tag="AT4G39370"
/gene_synonym="F23K16.5; F23K16_5; ubiquitin-specific
protease 27"
/note="A subfamily of Peptidase C19. Peptidase C19
contains ubiquitinyl hydrolases. They are intracellular
peptidases that remove ubiquitin molecules from
polyubiquinated peptides by cleavage of isopeptide bonds.
They hydrolyze bonds involving the carboxyl...; Region:
Peptidase_C19F; cd02662"
/db_xref="CDD:239127"
misc_feature <480..>1034
/gene="UBP27"
/locus_tag="AT4G39370"
/gene_synonym="F23K16.5; F23K16_5; ubiquitin-specific
protease 27"
/note="Ubiquitin C-terminal hydrolase [Posttranslational
modification, protein turnover, chaperones]; Region:
UBP12; COG5560"
/db_xref="CDD:227847"
misc_feature order(489..491,504..506,1608..1610,1698..1700)
/gene="UBP27"
/locus_tag="AT4G39370"
/gene_synonym="F23K16.5; F23K16_5; ubiquitin-specific
protease 27"
/note="active site"
/db_xref="CDD:239127"
ORIGIN
aattctatgtttacaagttacaatagttaggaaattgtaatttcaaatcaaataagctaaaaagatgttattattaaaatgttcagacgaattaaaccggacctaatttgcttggtcttttggccgctgaccttgtctgattgatcgggatttttgtacggcgaatcaaaatccaccgaacaaaccggaaggctaggatgctcaagctttacggattgacttagagagagatcgatttgaactgtgtcattttgagcatggtttctagaagaggctccgagacaaaagcgattgtctgtgtcctcacggatagaattaggatctctaatcaatgggtttcgcatttgtctttcgctggtctacttggtgttgctggtttcgtatttgcccaacagcacggtctattccgcaacttaaacaacttaaaactcttctccggtagagaaaaagactccggagacgattcttttctcgtacctggccttcaaaatctcggaaataactgcttcctcaacgtcatcctccaggctctagcgagctgcaaagattttaggagttttcttcaatgggttctagaggatgcgagaggttcgttagcaggagaacaagaggaacagcttcctcttacttttgctttgtctgctttattacaagagctcggcacagttggaagtagacgatctgtatctaaccctcgtaaagttatggtgacattgactgactatgccaaaaatttcaatttgacaagccaacaggatgcagcagaagcccttcttcatcttatatcttctttgcaagaagagattgtagtttgttatcgccctagccaaagtagtaatctttcggatatacttttctctcgcaacttgagaatgcttgcgcctagtgaaggcctccatggtttgatggagctcaagagatggcataaacatttgcgtggaccatttgatgggattcttggtagtactttaatgtgccgaacttgttcatctcagatttctttggagtttcagttttttcatactctgcctctttctcctttactccatcacggtggttacaacattatgtctggatgcactttggagcattgcttgaagaagtttcttaacactgagaaagttgaaaactacttctgctatagatgctggcatggtgctgcactgaaatatttatctgtgataggagcagctgagacggaaatcgaaaagctcaggagctgtggcggagaggaccaatgtgactgtaaaacttctcttcatcttcaaagaatgccttggtcaaatagctattcccatatattgaaacagttaatcatcgcccgtttcccaaaggtatttgcttactcattgaaactagacgtgaaactcctatgcattcaagtgcaacgcgcttcgtttaacatgtttgaggaattcaaactgtcgggacatatcgcatttccacttgtcttgaacctctccttgttcacaccatcttcaataggcgtaaacatagaagaaaggattgagatgtcgtcagagtaccaaaagccagaagcatcaaaaaatcacggcatgtacaggcttgtaacagtagtggagcattttggtagaaccggaagcgggcattatactgtatacagaagtgtgagagtgttctcacaagaggaagaagaagaagattgtgatgaggatttgagctggtttagtatatctgattcagaagtttgcagagtttcagagagtgatgttcttggtgctgaagctagcttgctcttctatgaaaggctttgataaaagagaaattaatttagagcttggttttcattggattgatcgagtgttctaaggtttcttttctgcacttggagaaattagaagatacgtgagtggagttgtttttgaatatattttcgcctatagc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]