2025-07-03 11:45:26, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS NM_001204036 1905 bp mRNA linear PLN 20-OCT-2022 DEFINITION Arabidopsis thaliana ubiquitin-specific protease 27 (UBP27), mRNA. ACCESSION NM_001204036 VERSION NM_001204036.1 DBLINK BioProject: PRJNA116 BioSample: SAMN03081427 KEYWORDS RefSeq. SOURCE Arabidopsis thaliana (thale cress) ORGANISM Arabidopsis thaliana Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis. REFERENCE 1 (bases 1 to 1905) AUTHORS Mayer,K., Schuller,C., Wambutt,R., Murphy,G., Volckaert,G., Pohl,T., Dusterhoft,A., Stiekema,W., Entian,K.D., Terryn,N., Harris,B., Ansorge,W., Brandt,P., Grivell,L., Rieger,M., Weichselgartner,M., de Simone,V., Obermaier,B., Mache,R., Muller,M., Kreis,M., Delseny,M., Puigdomenech,P., Watson,M., Schmidtheini,T., Reichert,B., Portatelle,D., Perez-Alonso,M., Boutry,M., Bancroft,I., Vos,P., Hoheisel,J., Zimmermann,W., Wedler,H., Ridley,P., Langham,S.A., McCullagh,B., Bilham,L., Robben,J., Van der Schueren,J., Grymonprez,B., Chuang,Y.J., Vandenbussche,F., Braeken,M., Weltjens,I., Voet,M., Bastiaens,I., Aert,R., Defoor,E., Weitzenegger,T., Bothe,G., Ramsperger,U., Hilbert,H., Braun,M., Holzer,E., Brandt,A., Peters,S., van Staveren,M., Dirske,W., Mooijman,P., Klein Lankhorst,R., Rose,M., Hauf,J., Kotter,P., Berneiser,S., Hempel,S., Feldpausch,M., Lamberth,S., Van den Daele,H., De Keyser,A., Buysshaert,C., Gielen,J., Villarroel,R., De Clercq,R., Van Montagu,M., Rogers,J., Cronin,A., Quail,M., Bray-Allen,S., Clark,L., Doggett,J., Hall,S., Kay,M., Lennard,N., McLay,K., Mayes,R., Pettett,A., Rajandream,M.A., Lyne,M., Benes,V., Rechmann,S., Borkova,D., Blocker,H., Scharfe,M., Grimm,M., Lohnert,T.H., Dose,S., de Haan,M., Maarse,A., Schafer,M., Muller-Auer,S., Gabel,C., Fuchs,M., Fartmann,B., Granderath,K., Dauner,D., Herzl,A., Neumann,S., Argiriou,A., Vitale,D., Liguori,R., Piravandi,E., Massenet,O., Quigley,F., Clabauld,G., Mundlein,A., Felber,R., Schnabl,S., Hiller,R., Schmidt,W., Lecharny,A., Aubourg,S., Chefdor,F., Cooke,R., Berger,C., Montfort,A., Casacuberta,E., Gibbons,T., Weber,N., Vandenbol,M., Bargues,M., Terol,J., Torres,A., Perez-Perez,A., Purnelle,B., Bent,E., Johnson,S., Tacon,D., Jesse,T., Heijnen,L., Schwarz,S., Scholler,P., Heber,S., Francs,P., Bielke,C., Frishman,D., Haase,D., Lemcke,K., Mewes,H.W., Stocker,S., Zaccaria,P., Bevan,M., Wilson,R.K., de la Bastide,M., Habermann,K., Parnell,L., Dedhia,N., Gnoj,L., Schutz,K., Huang,E., Spiegel,L., Sehkon,M., Murray,J., Sheet,P., Cordes,M., Abu-Threideh,J., Stoneking,T., Kalicki,J., Graves,T., Harmon,G., Edwards,J., Latreille,P., Courtney,L., Cloud,J., Abbott,A., Scott,K., Johnson,D., Minx,P., Bentley,D., Fulton,B., Miller,N., Greco,T., Kemp,K., Kramer,J., Fulton,L., Mardis,E., Dante,M., Pepin,K., Hillier,L., Nelson,J., Spieth,J., Ryan,E., Andrews,S., Geisel,C., Layman,D., Du,H., Ali,J., Berghoff,A., Jones,K., Drone,K., Cotton,M., Joshu,C., Antonoiu,B., Zidanic,M., Strong,C., Sun,H., Lamar,B., Yordan,C., Ma,P., Zhong,J., Preston,R., Vil,D., Shekher,M., Matero,A., Shah,R., Swaby,I.K., O'Shaughnessy,A., Rodriguez,M., Hoffmann,J., Till,S., Granat,S., Shohdy,N., Hasegawa,A., Hameed,A., Lodhi,M., Johnson,A., Chen,E., Marra,M., Martienssen,R. and McCombie,W.R. TITLE Sequence and analysis of chromosome 4 of the plant Arabidopsis thaliana JOURNAL Nature 402 (6763), 769-777 (1999) PUBMED 10617198 REFERENCE 2 (bases 1 to 1905) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (19-OCT-2022) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 1905) AUTHORS Krishnakumar,V., Cheng,C.-Y., Chan,A.P., Schobel,S., Kim,M., Ferlanti,E.S., Belyaeva,I., Rosen,B.D., Micklem,G., Miller,J.R., Vaughn,M. and Town,C.D. TITLE Direct Submission JOURNAL Submitted (17-MAY-2016) Plant Genomics, J. Craig Venter Institute, 9704 Medical Center Dr, Rockville, MD 20850, USA REMARK Protein update by submitter REFERENCE 4 (bases 1 to 1905) AUTHORS Swarbreck,D., Lamesch,P., Wilks,C. and Huala,E. CONSRTM TAIR TITLE Direct Submission JOURNAL Submitted (18-FEB-2011) Department of Plant Biology, Carnegie Institution, 260 Panama Street, Stanford, CA, USA COMMENT REVIEWED REFSEQ: This record has been curated by TAIR and Araport. This record is derived from an annotated genomic sequence (NC_003075). FEATURES Location/Qualifiers source 1..1905 /organism="Arabidopsis thaliana" /mol_type="mRNA" /db_xref="taxon:3702" /chromosome="4" /ecotype="Columbia" gene 1..1905 /gene="UBP27" /locus_tag="AT4G39370" /gene_synonym="F23K16.5; F23K16_5; ubiquitin-specific protease 27" /note="Encodes a ubiquitin-specific protease." /db_xref="Araport:AT4G39370" /db_xref="GeneID:830092" /db_xref="TAIR:AT4G39370" CDS 258..1775 /gene="UBP27" /locus_tag="AT4G39370" /gene_synonym="F23K16.5; F23K16_5; ubiquitin-specific protease 27" /note="ubiquitin-specific protease 27 (UBP27); FUNCTIONS IN: ubiquitin-specific protease activity, ubiquitin thiolesterase activity; INVOLVED IN: ubiquitin-dependent protein catabolic process; EXPRESSED IN: 19 plant structures; EXPRESSED DURING: 12 growth stages; CONTAINS InterPro DOMAIN/s: Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2, conserved site (InterPro:IPR018200), Peptidase C19, ubiquitin carboxyl-terminal hydrolase 2 (InterPro:IPR001394); BEST Arabidopsis thaliana protein match is: ubiquitin-specific protease 23 (TAIR:AT5G57990.1)." /codon_start=1 /product="ubiquitin-specific protease 27" /protein_id="NP_001190965.1" /db_xref="GeneID:830092" /db_xref="TAIR:AT4G39370" /db_xref="Araport:AT4G39370" /translation="
MVSRRGSETKAIVCVLTDRIRISNQWVSHLSFAGLLGVAGFVFAQQHGLFRNLNNLKLFSGREKDSGDDSFLVPGLQNLGNNCFLNVILQALASCKDFRSFLQWVLEDARGSLAGEQEEQLPLTFALSALLQELGTVGSRRSVSNPRKVMVTLTDYAKNFNLTSQQDAAEALLHLISSLQEEIVVCYRPSQSSNLSDILFSRNLRMLAPSEGLHGLMELKRWHKHLRGPFDGILGSTLMCRTCSSQISLEFQFFHTLPLSPLLHHGGYNIMSGCTLEHCLKKFLNTEKVENYFCYRCWHGAALKYLSVIGAAETEIEKLRSCGGEDQCDCKTSLHLQRMPWSNSYSHILKQLIIARFPKVFAYSLKLDVKLLCIQVQRASFNMFEEFKLSGHIAFPLVLNLSLFTPSSIGVNIEERIEMSSEYQKPEASKNHGMYRLVTVVEHFGRTGSGHYTVYRSVRVFSQEEEEEDCDEDLSWFSISDSEVCRVSESDVLGAEASLLFYERL"
misc_feature 480..1766 /gene="UBP27" /locus_tag="AT4G39370" /gene_synonym="F23K16.5; F23K16_5; ubiquitin-specific protease 27" /note="A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl...; Region: Peptidase_C19F; cd02662" /db_xref="CDD:239127" misc_feature <480..>1034 /gene="UBP27" /locus_tag="AT4G39370" /gene_synonym="F23K16.5; F23K16_5; ubiquitin-specific protease 27" /note="Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones]; Region: UBP12; COG5560" /db_xref="CDD:227847" misc_feature order(489..491,504..506,1608..1610,1698..1700) /gene="UBP27" /locus_tag="AT4G39370" /gene_synonym="F23K16.5; F23K16_5; ubiquitin-specific protease 27" /note="active site" /db_xref="CDD:239127" ORIGIN
aattctatgtttacaagttacaatagttaggaaattgtaatttcaaatcaaataagctaaaaagatgttattattaaaatgttcagacgaattaaaccggacctaatttgcttggtcttttggccgctgaccttgtctgattgatcgggatttttgtacggcgaatcaaaatccaccgaacaaaccggaaggctaggatgctcaagctttacggattgacttagagagagatcgatttgaactgtgtcattttgagcatggtttctagaagaggctccgagacaaaagcgattgtctgtgtcctcacggatagaattaggatctctaatcaatgggtttcgcatttgtctttcgctggtctacttggtgttgctggtttcgtatttgcccaacagcacggtctattccgcaacttaaacaacttaaaactcttctccggtagagaaaaagactccggagacgattcttttctcgtacctggccttcaaaatctcggaaataactgcttcctcaacgtcatcctccaggctctagcgagctgcaaagattttaggagttttcttcaatgggttctagaggatgcgagaggttcgttagcaggagaacaagaggaacagcttcctcttacttttgctttgtctgctttattacaagagctcggcacagttggaagtagacgatctgtatctaaccctcgtaaagttatggtgacattgactgactatgccaaaaatttcaatttgacaagccaacaggatgcagcagaagcccttcttcatcttatatcttctttgcaagaagagattgtagtttgttatcgccctagccaaagtagtaatctttcggatatacttttctctcgcaacttgagaatgcttgcgcctagtgaaggcctccatggtttgatggagctcaagagatggcataaacatttgcgtggaccatttgatgggattcttggtagtactttaatgtgccgaacttgttcatctcagatttctttggagtttcagttttttcatactctgcctctttctcctttactccatcacggtggttacaacattatgtctggatgcactttggagcattgcttgaagaagtttcttaacactgagaaagttgaaaactacttctgctatagatgctggcatggtgctgcactgaaatatttatctgtgataggagcagctgagacggaaatcgaaaagctcaggagctgtggcggagaggaccaatgtgactgtaaaacttctcttcatcttcaaagaatgccttggtcaaatagctattcccatatattgaaacagttaatcatcgcccgtttcccaaaggtatttgcttactcattgaaactagacgtgaaactcctatgcattcaagtgcaacgcgcttcgtttaacatgtttgaggaattcaaactgtcgggacatatcgcatttccacttgtcttgaacctctccttgttcacaccatcttcaataggcgtaaacatagaagaaaggattgagatgtcgtcagagtaccaaaagccagaagcatcaaaaaatcacggcatgtacaggcttgtaacagtagtggagcattttggtagaaccggaagcgggcattatactgtatacagaagtgtgagagtgttctcacaagaggaagaagaagaagattgtgatgaggatttgagctggtttagtatatctgattcagaagtttgcagagtttcagagagtgatgttcttggtgctgaagctagcttgctcttctatgaaaggctttgataaaagagaaattaatttagagcttggttttcattggattgatcgagtgttctaaggtttcttttctgcacttggagaaattagaagatacgtgagtggagttgtttttgaatatattttcgcctatagc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]