LOCUS       XM_077329069            2052 bp    mRNA    linear   VRT 27-SEP-2025
DEFINITION  PREDICTED: Paroedura picta copper chaperone for superoxide
            dismutase (CCS), transcript variant X1, mRNA.
ACCESSION   XM_077329069
VERSION     XM_077329069.1
DBLINK      BioProject: PRJNA1334391
KEYWORDS    RefSeq.
SOURCE      Paroedura picta
  ORGANISM  Paroedura picta
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Lepidosauria; Squamata; Bifurcata; Gekkota; Gekkonidae; Gekkoninae;
            Paroedura.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_135369) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_049243985.1-RS_2025_09
            Annotation Pipeline         :: NCBI Eukaryotic Genome Annotation
                                           Pipeline (EGAP)
            Annotation Software Version :: 10.5
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 09/25/2025
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2052
                     /organism="Paroedura picta"
                     /mol_type="mRNA"
                     /isolate="Pp20150507F"
                     /db_xref="taxon:143630"
                     /chromosome="1"
                     /sex="female"
                     /tissue_type="blood"
                     /collection_date="2019-05-08"
     gene            1..2052
                     /gene="CCS"
                     /note="copper chaperone for superoxide dismutase; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 13 Proteins, and 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 16 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:143833356"
     CDS             88..903
                     /gene="CCS"
                     /codon_start=1
                     /product="copper chaperone for superoxide dismutase
                     isoform X1"
                     /protein_id="XP_077185184.1"
                     /db_xref="GeneID:143833356"
                     /translation="

MEAASGGAGGVRCRLEFAVQMTCQSCVEAVQAALQEVPGIQLLDVNLDSQSVLLETSLQTEKVHSLLESTGRKAVLKGMGGTMPQPFGSAAVAIISGPGSVQGVVRFLQMSQEKCLIDGTVDGLEPGSHGLHVHEFGDITSSCDSCGDHFNPDGNCHGGPQDLYRHAGDLGNILAADDGRASFRMEDSQLKVYDIIGRSLVVDAGEDDLGRGRHPLSKVTGNSGERVACGIIARSAGLFQNPKRVCTCDGVTLWEEQEKLGRKAASQPAHL"

     misc_feature    130..852
                     /gene="CCS"
                     /note="copper, zinc superoxide dismutase; Region:
                     PLN02957"
                     /db_xref="CDD:215516"
     polyA_site      2052
                     /gene="CCS"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      

ggatttccgatctcttgatgttgtgtgtcctgttgaaaggagtccgggcggggaacgtttctcattaggaaaggaaggtgctacgaaatggaggcggcttctggaggggctggcggtgtcaggtgtcggctggagtttgctgtccagatgacctgtcagagttgtgtggaggcagtgcaggcagctcttcaagaagtaccaggcatccagctgcttgatgtcaatctagattcccaaagtgtgctgctagagaccagcctccaaacagagaaagtccacagccttttggaaagcactggacgcaaggctgtgctaaaaggaatgggaggcactatgccacagccatttggcagcgcagcagtggctataatatcaggccctggatcagtgcagggtgtggtgaggttcttgcagatgtcccaagagaaatgtctcattgatggcaccgtggatggtttggagccaggctcacatggcctgcacgttcacgaatttggggacatcaccagttcctgtgacagctgtggggaccacttcaaccctgatgggaactgccatgggggcccacaggacctgtacaggcatgctggggatcttgggaatatcctggctgctgatgatggaagggcttcttttcggatggaagacagccagttgaaggtctatgacatcattgggcgttccttggtggtagatgcaggagaggatgacttgggacgtggcaggcacccactctcaaaagttacgggcaattcaggcgagagagtggcctgtggaatcattgctcgctctgctggcctcttccagaaccccaagagagtatgtacctgcgatggagtgacactgtgggaagaacaagaaaaattgggcaggaaggcagctagccagccagctcatctttaagatatctggctgaccctgcaccacctctgctgcagatttatcggtctgtttggcataagactctttagggcacttgtgctgaaggggtgtgcttgtggccggttgcaacaaggccagtcaggcctagtcaccttgatacctatgcctagcagtgacataagtggggtgggcatattgctttcacaagtggcaatgattgggcagccactcagcgtatggccctgcaaactctactctgtatagaaacattccaagaaaagcattgactctctggatggaggcttctgcatgcacattgtttccccactctggttgcgtggccatcttttcctaatcctcccactttttcctggtctcttacggggttgattgtagcaaacagcaataaattaggtgcagctacatggatgcacagtaaaggcaaaaacttagcctgttgtatagctgctggttatttgaattaaaagctttgtggcctagctggggaggaggcgacatcttggaaaggtgtaagtggcccttgctgtgaaggagtatcccatcagtttaatctttcctttgaattaggaaaatgtgtggaaggtggctatgctgcttttttatggggaattgtttttacccttcggtgtctctggttgatacatgaattcagtgggtgtgtttaacattaacttctaagtattgtacaaaagtgccttaatttcagacatgcttacttgattcccttttgaaacactgtcttccctgttgtgagaggctggcaggatgttggggcaacatgggaaggaggatcaccctcagtgatcctgcatacaaaggtactttacaaacatagattactcttttggccacatacttgcaatcatctttctcccactgtcagtgcatcctgataaacaaaatgagggatcataagccaaggcagaaattatgagtgacagcactgcaaagggtcatttattctggagtgattaatacaaaattcaagggtgtaattgtctgggaattgtagcagattattgaagaagggaatctcttttgctttgtatgttggatggagggaatgttaagagagaattctcaggtgtgcattctctaggcccattgtgatcttaaatcaatcattaaattttgcattcttacacggta

//