GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-09-18 11:53:57, GGRNA.v2 : RefSeq release 231 (Jul, 2025)

LOCUS       XM_073401181             525 bp    mRNA    linear   INV 22-APR-2025
DEFINITION  PREDICTED: Porites lutea uncharacterized protein (LOC140951828),
            mRNA.
ACCESSION   XM_073401181
VERSION     XM_073401181.1
DBLINK      BioProject: PRJNA1248014
KEYWORDS    RefSeq.
SOURCE      Porites lutea
  ORGANISM  Porites lutea
            Eukaryota; Metazoa; Cnidaria; Anthozoa; Hexacorallia; Scleractinia;
            Fungiina; Poritidae; Porites.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_133211) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_958299795.1-RS_2025_04
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 04/10/2025
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..525
                     /organism="Porites lutea"
                     /mol_type="mRNA"
                     /db_xref="taxon:51062"
                     /chromosome="11"
     gene            1..525
                     /gene="LOC140951828"
                     /note="uncharacterized LOC140951828; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:140951828"
     CDS             48..506
                     /gene="LOC140951828"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_073257282.1"
                     /db_xref="GeneID:140951828"
                     /translation="
MGSAFSSFQERRKTRVELKRKHKLYGSMSASKRKEVMRFKTRMEQQIEALNKQIASEKRALSLARANNLRKSVWSLQDQEPTKKPLAGKDFQDGQFHLSEYHRLLLEACQFAKYTSEHPLEKWTVCSLPNLYKSSVEKCQPRRWEFKTPSLS"
ORIGIN      
gtttttgcgagtagacaaaccagagaaacatttgtagaataatcgatatgggaagtgcttttagttctttccaagaacgcagaaagacgagagtggaacttaaaagaaagcacaaactttatggctccatgtctgcttccaaaaggaaggaagtaatgaggttcaaaactcgaatggaacaacaaattgaagctctgaacaaacagattgctagcgaaaaaagagctctatcattagccagagctaacaatcttagaaagtctgtctggtctcttcaagatcaagagccgacaaagaaaccgctagcgggaaaagacttccaagatggccagtttcatctgtctgaatatcatagactattacttgaagcctgtcagtttgccaagtacactagtgagcatccacttgaaaagtggactgtctgttcacttcctaatttgtacaaatcttctgttgagaaatgccaaccaagacgctgggaattcaaaactccgagcctttcataaagaattgaaaaatatatgc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]