2025-08-29 22:35:39, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS XM_071457434 1288 bp mRNA linear VRT 15-FEB-2025 DEFINITION PREDICTED: Trachinotus anak vimentin-related 2 (vimr2), transcript variant X2, mRNA. ACCESSION XM_071457434 VERSION XM_071457434.1 DBLINK BioProject: PRJNA1223932 KEYWORDS RefSeq. SOURCE Trachinotus anak (oyster pompano) ORGANISM Trachinotus anak Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Neoteleostei; Acanthomorphata; Carangaria; Carangiformes; Carangidae; Trachinotus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_027273872) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_046630095.1-RS_2025_02 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 02/14/2025 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1288 /organism="Trachinotus anak" /mol_type="mRNA" /isolate="AG129_WGS33_773" /db_xref="taxon:443729" /chromosome="Unknown" /sex="female" /tissue_type="heart" /ecotype="Australia" /geo_loc_name="Australia: Bribie Island Research Centre, Queensland" /collection_date="2024" gene 1..1288 /gene="vimr2" /note="vimentin-related 2; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:139605713" CDS 97..1137 /gene="vimr2" /codon_start=1 /product="alpha-internexin isoform X2" /protein_id="XP_071313535.1" /db_xref="GeneID:139605713" /translation="
MAMLRVSSYRKLFEDDNWSRNGGLGMQCAGQYQTSVRVAAVDDCDCDKLDFVAARSLNKEGLKRFAQDRTIIAALNDRLVRLIELAHCFEKENESLECQIVELEEKLNSQQASSSITSTVAHPDYSLDAVVERLRKERDEILCDTEELQKELEFLKKGCEKAAQQRIFFQQERQDVAEEVDAVTAECLALREQVAIYEEQLANMEAQHKTAVERLLEPGEATTGAVAAIRFSSPDITPALDVKEYYCQLAASLQISGLEKELAELEKCNEELEDEIEMKTAAYMDEIAELECTIDEMRHQEADLQAQMKEQCEDYKELLSEKMARDLEIVAYRSLVEEEEQRLCNL"
misc_feature 295..1122 /gene="vimr2" /note="Intermediate filament protein; Region: Filament; pfam00038" /db_xref="CDD:459643" ORIGIN
acattctcattccctgtgattataaaactcccaccgtggtcctgctgtctctgtttgcctgttgtgttgtagcccagtttgaagccgtccgaagtcatggccatgctcagggtgtcttcttaccgcaagctgtttgaggatgataactggagtcgaaatggagggttaggtatgcagtgtgccgggcagtaccagacctccgtcagggttgcagccgttgacgactgtgactgtgacaagttagacttcgtggctgccaggtctctcaacaaggagggtctgaagcggtttgcccaggaccgcaccatcatcgctgcccttaatgaccgcctggtcaggcttattgaactggcccattgttttgagaaagagaatgagtctcttgaatgtcagattgtggagctagaggagaagctgaacagtcaacaagcctcctccagcatcacctccactgtggctcaccccgactacagcctggatgcagtggtggaaagactgcgcaaggagagggacgagattctgtgtgacactgaggagctgcagaaggagctcgaatttctgaagaaaggctgcgagaaggctgcacagcagaggatcttcttccagcaggaacgacaagatgttgctgaggaagtggatgctgtgacagcagagtgtttggcgctgagggagcaagtggctatctacgaggagcagctggccaacatggaggcccagcacaagacggcagtggagcgtctgctggagccaggtgaagcgacgacaggggcggtggcagcgataagatttagcagccctgacatcactccggccttggatgtaaaggagtactactgccagctggccgcgagcctccagatttcagggctggaaaaggagcttgcagagcttgagaagtgtaatgaggagctggaggacgagattgagatgaagacggctgcgtacatggacgagattgctgagctggagtgtactatagatgaaatgcggcaccaggaggccgacctccaagcgcagatgaaggagcagtgtgaggactacaaggagctgctcagtgagaagatggccagagacttggagatcgtcgcttacaggagtctggtggaggaagaggagcagaggctgtgcaacctgtgaaatgaggctgaagagtcagactggccggctggggtttggttggatgctcccctcccacatgtggatgagaaaacagacaaaagaaaatcacaaaaaccagacacaaatcagcactagggtgaagcttaaggtaccaacgcagcagatgtaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]