2025-07-01 05:00:16, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_071420187 1458 bp mRNA linear VRT 15-FEB-2025 DEFINITION PREDICTED: Agelaius tricolor NADH-ubiquinone oxidoreductase chain 4-like (LOC139586641), mRNA. ACCESSION XM_071420187 VERSION XM_071420187.1 DBLINK BioProject: PRJNA1221961 KEYWORDS RefSeq; includes ab initio. SOURCE Agelaius tricolor (tricolored blackbird) ORGANISM Agelaius tricolor Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Neoaves; Telluraves; Australaves; Passeriformes; Passeroidea; Icteridae; Agelaius. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_027269388) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_023055355.1-RS_2025_02 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 02/12/2025 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1458 /organism="Agelaius tricolor" /mol_type="mRNA" /isolate="1412-34295" /db_xref="taxon:9191" /chromosome="Unknown" /sex="female" /tissue_type="blood" /dev_stage="adult" /lat_lon="36.4692 N 121.7914 W" gene 1..1458 /gene="LOC139586641" /note="NADH-ubiquinone oxidoreductase chain 4-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:139586641" CDS 1..1458 /gene="LOC139586641" /codon_start=1 /product="NADH-ubiquinone oxidoreductase chain 4-like" /protein_id="XP_071276288.1" /db_xref="GeneID:139586641" /translation="
MGMVIMVIMVIMIGMSMGAVIMVIGMGMVIVIVIMGMVIMVRGMVIMGIVIIIMGMVIMVMVMVMVISVMVIITGMVIMVIIMGMVIMVIVIIIMVMDMVIMVIVMIMVSIIIMGMVIMMVMVIMVMVISVMVIIMGMGMVIMVIMVMVIIIGMSTGTVIMVISIGMVIMGMVIIIIIVMIMVSIIIMVMVILVMIIIMGMGMVIMVIMRMGIIVMVIISFVMVIMVMVTVMMVIMGMDTMVMIIIMGMDVVIIMGMVMVIMGIVSISIIVIVMVIVMVMIMVIMGMVIMIMVVMVMGMVIIMGMGIMVMVMVMVMVSIISFIIVIIVGMGMVIIMGMGRIMVIMAMVIIVSVMVMVSIMVMAMVIMVMVMGMVIIDIVMVIIIIIVIDIVIIDILNLIINIFILIIIIPKLSSSQPCPHLHRPLHSIPIIILIIFIPKFSLSELHPPPHCFILILIIFIPKFSLSEPHPPPHHPHPLHPEVLLV"
ORIGIN
atgggcatggtcatcatggtcatcatggtcatcatgatcggaatgagcatgggcgcggtcatcatggtcatcggcatgggcatggtcattgtcattgtcatcatgggcatggtcatcatggtcaggggcatggtcatcatgggcattgttattatcatcatgggcatggtcatcatggtcatggtcatggtcatggtcatctcggtcatggtcatcatcacgggcatggtcatcatggtcattatcatgggcatggtcatcatggtcattgttattatcatcatggtcatggacatggtcatcatggtcatcgtcatgatcatggtcagcatcatcatcatgggcatggtcatcatgatggtcatggtcatcatggtcatggtcatctcggtcatggtcatcatcatgggcatgggcatggtcatcatggtcatcatggtcatggtcatcatcatcggaatgagcacgggcacagtcatcatggtcatcagcataggcatggtcatcatgggcatggtcatcatcatcatcattgtcatgatcatggtcagcatcatcatcatggtcatggtcatcttggtcatgatcatcatcatgggcatgggcatggtcatcatggtcatcatgagaatgggcatcatagtcatggtcatcatcagcttcgtaatggtcatcatggtcatggtcaccgtcatgatggtcatcatgggcatggacaccatggtcatgatcatcatcatgggcatggacgtggtcatcatcatgggcatggtcatggtcatcatgggcattgtcagcatcagcatcattgtcattgtcatggtcattgtcatggtcatgatcatggtcatcatgggcatggtcatcatgatcatggtggtcatggtcatgggcatggtcataatcatgggcatgggcatcatggtcatggtcatggtcatggtcatggtcagcatcatcagcttcatcatcgtcatcattgtaggcatgggcatggtcatcatcatgggcatgggcaggatcatggtcatcatggccatggtcatcattgtcagtgtcatggtcatggtcagcatcatggtcatggccatggtcatcatggtcatggtcatgggcatggtcatcattgacattgtcatggtcatcatcatcatcatcgtcatcgacattgtcatcattgacattctcaacctcatcatcaacatcttcatcctcatcatcatcatcccaaagttgtcctcatcccaaccctgccctcatcttcaccgtcctcttcattccatccccatcatcatcctcatcatcttcatcccaaagttctccttgtccgaactccatcctcctcctcattgtttcatcctcatcctcatcatcttcatcccaaagttctccttgtctgaaccccatcctcctcctcatcatcctcatcctcttcatcctgaagttctccttgtctga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]