GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-08-20 17:54:21, GGRNA.v2 : RefSeq release 230 (May, 2025)

LOCUS       XM_071062604            1035 bp    mRNA    linear   PLN 31-JAN-2025
DEFINITION  Madurella fahalii Metal homeostatis protein bsd2
            (MFIFM68171_07184), partial mRNA.
ACCESSION   XM_071062604
VERSION     XM_071062604.1
DBLINK      BioProject: PRJNA1216027
            BioSample: SAMD00817542
            Sequence Read Archive: DRR594085, DRR594086
KEYWORDS    RefSeq.
SOURCE      Madurella fahalii
  ORGANISM  Madurella fahalii
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Sordariomycetes; Sordariomycetidae; Sordariales; Sordariales
            incertae sedis; Madurella.
REFERENCE   1
  AUTHORS   Yoshioka,I., Fahal,A.H., Kaneko,S. and Yaguchi,T.
  TITLE     Itraconazole resistance in Madurella fahalii resulting from another
            homologue of gene encoding cytochrome P450 14-alpha sterol
            demethylase (CYP51)
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1035)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (30-JAN-2025) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1035)
  AUTHORS   Yaguchi,T. and Yoshioka,I.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-SEP-2024) Contact:Takashi Yaguchi Chiba University,
            Medical Mycology Research Center; 1-8-1 Inohana, Chuo-ku, Chiba,
            Chiba 260-8673, Japan
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_027263974).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..1035
                     /organism="Madurella fahalii"
                     /mol_type="mRNA"
                     /strain="IFM 68171"
                     /isolation_source="Mycetoma"
                     /host="Homo sapiens"
                     /culture_collection="IFM:68171"
                     /db_xref="taxon:1157608"
                     /chromosome="Unknown"
                     /geo_loc_name="Sudan"
                     /collection_date="2022"
     gene            <1..>1035
                     /locus_tag="MFIFM68171_07184"
                     /db_xref="GeneID:98177927"
     CDS             1..1035
                     /locus_tag="MFIFM68171_07184"
                     /note="COG:O;
                     EggNog:ENOG503NW1W;
                     GO_component: GO:0005783 - endoplasmic reticulum [Evidence
                     IEA];
                     GO_component: GO:0005794 - Golgi apparatus [Evidence IEA];
                     GO_component: GO:0048471 - perinuclear region of cytoplasm
                     [Evidence IEA];
                     GO_process: GO:0006511 - ubiquitin-dependent protein
                     catabolic process [Evidence IEA];
                     GO_process: GO:0007034 - vacuolar transport [Evidence
                     IEA];
                     GO_process: GO:0030001 - metal ion transport [Evidence
                     IEA];
                     GO_process: GO:0031398 - positive regulation of protein
                     ubiquitination [Evidence IEA];
                     InterPro:IPR019325;
                     PFAM:PF10176;
                     TransMembrane:2 (i192-213o291-309i)"
                     /codon_start=1
                     /product="Metal homeostatis protein bsd2"
                     /protein_id="XP_070918705.1"
                     /db_xref="GeneID:98177927"
                     /translation="
MSGRYERVNARDEDEPETPTAPLPRPTYPIPNSPPPSFHSRPSSISSRERENGVDPDLADAFDADGDDSDDEADDRQRLVRGNSTPSFVSATQAGAASQSGAEPGRSQRPVGVVPTTSRVYGSGIQSDGVFSNLSAKPERGDGEKDELPPSYEQAAADAAPPYWETTILAPGLGGPDDVYIDGMPVGSLFGFIWNAMISMAFHLIGFLLTYLLHSTHAAKNGSRAGLGVTLIQYGFYMKSTPPGSSGGPNPQSDDDTYANPSNPNSHNFNPDEVNQGDGDGGSGDITSSDWAAYILMVVGWFILIRAVSDYLKVRRHEQLVLQSPDRGLGVPIIATGERPDTVV"
     misc_feature    358..981
                     /locus_tag="MFIFM68171_07184"
                     /note="Protein of unknown function (DUF2370); Region:
                     DUF2370; pfam10176"
                     /db_xref="CDD:401984"
ORIGIN      
atgtcgggccggtatgaaagggtgaacgcccgcgacgaggacgaacccgaaacaccgacggcccccttgccaaggccgacctaccccatccccaactcgccgccgccttcgttccactccagaccgtcgtccataagctccagggaaagggagaacggagtcgacccggacctagccgacgcattcgatgccgacggtgatgatagcgacgacgaggcagacgataggcagcggttagtgcgcggcaattcgacaccctcatttgtcagcgctacgcaagcgggtgcggcatcgcaatctggggcagagccgggccggtcgcaaaggccggtgggagtggtaccgaccacgtcgagggtctacggcagcggcatccagtctgacggcgtgttctcgaacctctcggcaaagccggagcggggtgatggcgaaaaggacgagctgcctccatcctacgaacaagcggcagccgacgcggctcccccttattgggaaacgaccatcctcgcgcctggcctcggcggccccgacgatgtctacatcgacggcatgcccgtgggctctttgttcggcttcatctggaacgccatgatctcgatggccttccatttgatcggcttcctgcttacctacttgctccactcaacccacgcggccaagaacggttcccgggcaggtttgggtgtcacccttatccagtacggcttctacatgaagagcacgccgcctggcagctcgggagggccgaatccgcagagcgacgacgacacatacgcgaacccgtcgaatccgaactcgcacaacttcaatccggacgaggtgaaccagggggatggcgatggcggctctggggatatcacgagcagcgactgggctgcgtatattttgatggtggttggctggttcattctgattcgggcggtcagcgattacttgaaagtgcggaggcatgagcagctggtcttacagagccctgatcggggtctcggtgttcccatcattgccacgggcgagaggcccgacacggtggtatag
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]