2025-10-16 18:11:42, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS XM_071059986 207 bp mRNA linear PLN 31-JAN-2025 DEFINITION Madurella fahalii uncharacterized protein (MFIFM68171_04566), partial mRNA. ACCESSION XM_071059986 VERSION XM_071059986.1 DBLINK BioProject: PRJNA1216027 BioSample: SAMD00817542 Sequence Read Archive: DRR594085, DRR594086 KEYWORDS RefSeq. SOURCE Madurella fahalii ORGANISM Madurella fahalii Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Sordariomycetes; Sordariomycetidae; Sordariales; Sordariales incertae sedis; Madurella. REFERENCE 1 AUTHORS Yoshioka,I., Fahal,A.H., Kaneko,S. and Yaguchi,T. TITLE Itraconazole resistance in Madurella fahalii resulting from another homologue of gene encoding cytochrome P450 14-alpha sterol demethylase (CYP51) JOURNAL Unpublished REFERENCE 2 (bases 1 to 207) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (30-JAN-2025) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 207) AUTHORS Yaguchi,T. and Yoshioka,I. TITLE Direct Submission JOURNAL Submitted (05-SEP-2024) Contact:Takashi Yaguchi Chiba University, Medical Mycology Research Center; 1-8-1 Inohana, Chuo-ku, Chiba, Chiba 260-8673, Japan COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_027263972). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..207 /organism="Madurella fahalii" /mol_type="mRNA" /strain="IFM 68171" /isolation_source="Mycetoma" /host="Homo sapiens" /culture_collection="IFM:68171" /db_xref="taxon:1157608" /chromosome="Unknown" /geo_loc_name="Sudan" /collection_date="2022" gene <1..>207 /locus_tag="MFIFM68171_04566" /db_xref="GeneID:98175309" CDS 1..207 /locus_tag="MFIFM68171_04566" /note="COG:U; EggNog:ENOG503P8WP; GO_component: GO:0005783 - endoplasmic reticulum [Evidence IEA]; InterPro:IPR010580; PFAM:PF06624; TransMembrane:1 (o44-67i)" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_070916087.1" /db_xref="GeneID:98175309" /translation="
MAQTPQQRRANLKFAKEQEARRGKSEDQIKKRAKDLPKSPISPIWLILLGFVVFGGLIFEVISRVFLR"
misc_feature 4..186 /locus_tag="MFIFM68171_04566" /note="Ribosome associated membrane protein RAMP4; Region: RAMP4; pfam06624" /db_xref="CDD:461965" ORIGIN
atggcgcaaacaccccaacaacgacgggcaaacctcaagtttgccaaggagcaggaggcccggcgcggcaagtccgaggaccagatcaagaagcgggccaaggacttgcccaagtcccccatctccccaatctggctcatccttcttggtttcgtcgtcttcggcggtctcatcttcgaggtcatctcccgtgtcttcctgcgatga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]