ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2025-12-09 09:29:45, GGRNA.v2 : RefSeq release 232 (Sep, 2025)
LOCUS XM_070775634 1729 bp mRNA linear MAM 07-JAN-2025 DEFINITION PREDICTED: Bos indicus dicer 1, ribonuclease III (DICER1), transcript variant X7, mRNA. ACCESSION XM_070775634 VERSION XM_070775634.1 DBLINK BioProject: PRJNA1197407 KEYWORDS RefSeq. SOURCE Bos indicus (Bos taurus indicus) ORGANISM Bos indicus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae; Bovinae; Bos. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091780) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_029378745.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/12/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1729 /organism="Bos indicus" /mol_type="mRNA" /isolate="NIAB-ARS_2022" /db_xref="taxon:9915" /chromosome="21" /sex="female" /tissue_type="blood" /dev_stage="calf" /collected_by="NIAB" /breed="Sahiwal x Tharparkar" /note="offspring of Sahiwal sire and Tharparkar dam" gene 1..1729 /gene="DICER1" /note="dicer 1, ribonuclease III; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:109575356" CDS 350..1729 /gene="DICER1" /codon_start=1 /product="endoribonuclease Dicer isoform X2" /protein_id="XP_070631735.1" /db_xref="GeneID:109575356" /translation="
MKSPALQPLSMAGLQLMTPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAALDHNTIVCLNTGSGKTFIAVLLTKELSYQIRGDFNRNGKRTVFLVNSANQVAQQVSAVRTHSDLKVGEYSNLEVSASWTKEKWNQEFTKHQVLVMTCYVALNVLKNGYLSLSDINLLVFDECHLAILDHPYREIMKLCENCPSCPRILGLTASILNGKCDPEELEEKIQKLEKILKSNAETATDLVVLDRYTSQPCEIVVDCGPFTDRSGLYERLLMELEEALNFINDCNISVHSKERDSTLISKQILSDCRAVLVVLGPWCADKVAGMMVRELQKHIKHEQEELHRKFLLFTDTFLRKIHALCEEHFSPASLDLKFVTPKVIKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWSDSEDDEEDEEIEEKEKPETNFPSPFTNILCGIIFVERRYTAVVLNR"
misc_feature 473..1066
/gene="DICER1"
/note="DEXH-box helicase domain of endoribonuclease Dicer;
Region: DEXHc_dicer; cd18034"
/db_xref="CDD:350792"
misc_feature order(473..484,491..493,542..565,686..688,875..877,
968..970)
/gene="DICER1"
/note="ATP binding site [chemical binding]; other site"
/db_xref="CDD:350792"
misc_feature order(650..655,722..727,800..802,806..811,818..820,
893..901)
/gene="DICER1"
/note="nucleic acid binding site [nucleotide binding];
other site"
/db_xref="CDD:350792"
misc_feature 1160..1444
/gene="DICER1"
/note="Partner-binding domain of the endoribonuclease
Dicer; Region: Dicer_PBD; cd15903"
/db_xref="CDD:277191"
misc_feature order(1175..1180,1187..1189,1193..1198,1373..1378,
1385..1390,1397..1399,1406..1411,1418..1420)
/gene="DICER1"
/note="Trbp binding interface [polypeptide binding]; other
site"
/db_xref="CDD:277191"
misc_feature 1463..>1726
/gene="DICER1"
/note="Members of the P-loop NTPase domain superfamily are
characterized by a conserved nucleotide phosphate-binding
motif, also referred to as the Walker A motif
(GxxxxGK[S/T], where x is any residue), and the Walker B
motif (hhhh[D/E], where h is a...; Region: P-loop
containing Nucleoside Triphosphate Hydrolases; cl38936"
/db_xref="CDD:476819"
ORIGIN
gggacgaggcgacggcgagcgggaggacatggcggcggcggcggcggcgccgggcggcaccgggaggcctgggctgtgacgcgcgcgccggagcgggggtccgatggttctcgaaggcccgcggcgccccgtgctgcaggttacctagggtatgaattaatacagacttggaaactgaaagaacttagaatcagcattttgagagcagaagcttgggtatgctgtgattttccaataaactgctatcacaatgtcaaaatgcagttcagacaacagcaacacagagatctcaaacattaagacgtaagctgtgctagaacaaaaatgcaatgaaagagacactggatgaatgaaaagccctgctttgcaacccctcagcatggcaggcctgcagctcatgacccctgcttcctcaccaatgggtcctttctttggactgccatggcaacaagaagcaattcatgataacatttatacgccaagaaaatatcaggttgaactgcttgaagcagctctggatcataataccatagtctgtttaaacactggctcagggaagacgtttattgcagtactactcactaaagagctgtcttatcagatcaggggagacttcaacagaaatggcaaaaggacggtgttcttggtcaactctgcaaaccaggttgcccaacaagtgtcagctgtcagaactcactcagatctcaaggtcggggaatactcaaacctagaagtaagtgcatcttggacaaaagagaaatggaaccaagagtttactaaacatcaggttctcgttatgacttgctatgtcgccttgaatgttttgaaaaatggttacttatcactgtcagacattaaccttttggtgtttgatgagtgtcatcttgcaatcctagaccacccctaccgagaaattatgaagctttgtgaaaattgtccatcatgtcctcgtattttgggactaactgcttccattttaaatgggaaatgtgatccagaggaattggaagagaagattcagaaactggagaaaattcttaagagtaatgctgaaactgcaactgacttggtggtcttagacagatatacttctcagccatgtgagattgtggtagactgtggaccatttactgacagaagtgggctttatgaaagactgctgatggagttagaagaagcacttaattttatcaatgactgtaacatatctgtacattcaaaagaaagagattctactttaatttctaaacagatactctcagactgccgtgcggtcctggttgtcctgggaccctggtgtgccgataaagtagctggaatgatggtcagagagctgcagaaacacatcaaacatgagcaggaggagctgcaccggaagtttctgttgttcacagacactttcctacggaaaatccacgccctgtgtgaagagcacttctcccctgcctcgcttgacctgaagtttgtcactcctaaagtaataaagctgctcgagatcttacgcaaatacaaaccgtatgagcggcagcagtttgaaagcgtggagtggtataataataggaaccaggataattacgtgtcctggagcgattctgaggatgacgaggaagatgaagagattgaagagaaagaaaagccagagacaaattttccttctccgtttaccaacattttgtgtggaattatttttgtggaaagaagatacacagccgtggtcttaaacaggtaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]