GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-08-29 11:13:46, GGRNA.v2 : RefSeq release 231 (Jul, 2025)

LOCUS       XM_070498741            1779 bp    mRNA    linear   MAM 18-DEC-2024
DEFINITION  PREDICTED: Equus asinus Meis homeobox 3 (MEIS3), transcript variant
            X3, mRNA.
ACCESSION   XM_070498741
VERSION     XM_070498741.1
DBLINK      BioProject: PRJNA1198117
KEYWORDS    RefSeq.
SOURCE      Equus asinus (donkey)
  ORGANISM  Equus asinus
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091815) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_041296235.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Best-placed RefSeq; Gnomon;
                                           cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/16/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1779
                     /organism="Equus asinus"
                     /mol_type="mRNA"
                     /isolate="D_3611"
                     /db_xref="taxon:9793"
                     /chromosome="26"
                     /sex="male"
                     /tissue_type="Whole blood in anticoagulant"
                     /geo_loc_name="USA: Ithaca, New York"
                     /collection_date="2018-03-01"
                     /breed="Donkey"
     gene            1..1779
                     /gene="MEIS3"
                     /note="Meis homeobox 3; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 5 long SRA reads"
                     /db_xref="GeneID:106845156"
     CDS             153..1307
                     /gene="MEIS3"
                     /codon_start=1
                     /product="homeobox protein Meis3 isoform X2"
                     /protein_id="XP_070354842.1"
                     /db_xref="GeneID:106845156"
                     /translation="
MARRYDELPHYPGIVDGTAALAGFSEAVPTAPRAPGPYGPHRPPQPPPLGLDSDGLKREKDEIYGHPLFPLLALVFEKCELATCSPRDVAGAGLGTPPGGDLCSSDSFNEDIAAFAKQVRSERPLFSSNPELDNLMIQAIQVLRFHLLELEKGKMPIDLVIEDRDGGCREDLEDYPASCPSLPDQTNTWIRDHEDSGSVHLGTPGPSSGGLASQSGDNSSDQGDGLDTSVASPSSGGEDEELDQERRRNKKRGIFPKVATNIMRAWLFQHLSMTGQALGIGWRPGRQGDSRWWSQHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGAAFSPEGQPVGGYTETQPHMTVRPPGSMGMSLNLEGEWHYL"
     misc_feature    447..650
                     /gene="MEIS3"
                     /note="N-terminal of Homeobox Meis and PKNOX1; Region:
                     Meis_PKNOX_N; pfam16493"
                     /db_xref="CDD:465140"
     misc_feature    1038..1136
                     /gene="MEIS3"
                     /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920"
                     /db_xref="CDD:428673"
ORIGIN      
cggccgtgggggggtgggggagccgggcacccagcctcctgccccaccccctggcgtcggccccatcggccacccgggccgctgcccctggctgcgccctccccgccggccaggccctggagggacccgggagcggccgccggcttcagcccatggcccggaggtacgatgagctgcctcactacccaggcatcgtggatggcactgcagccctggctggcttctcggaggcagtgcccacagcaccgagagccccggggccctacggcccccaccggcctcctcagccccctcccctgggcttggacagcgatggcctgaagagagagaaggacgagatctacggacacccgctcttccccctgctggccctggtctttgagaaatgtgaactggccacgtgctcacctcgtgacgtggccggggctgggctgggcacgcccccgggcggcgacctctgctcctccgactccttcaatgaggacattgccgcttttgccaagcaggtccgctccgagaggcccctcttctcctccaacccggagctggacaatctgatgatccaggccatccaggtgctccggttccacctgctggagctggagaagggaaagatgcccatcgacctggtcatcgaggatcgggacggcggctgcagggaggacctcgaggactacccggcctcctgccccagcctcccggatcagactaacacatggattagagaccatgaggacagtgggtctgtacatttggggaccccgggtccatccagtggtggcctggcctcccagagtggggacaactctagtgaccaaggagacggactggacacaagcgtggcctctcccagttctgggggagaggacgaggagctggaccaggagcggcgtcggaacaagaagcggggcatcttccccaaggtggccaccaacatcatgagagcctggctgttccagcacctctcgatgacaggccaggccttggggatcggatggcggcccggcaggcagggtgactctcgctggtggtcacagcacccgtacccctcggaggagcagaagaaacagctggcgcaggacacggggctcacgattctgcaagtcaacaactggttcattaacgcccggagacgcatcgtgcaacccatgatcgatcaatccaaccgcacagggcagggtgcagccttcagcccagagggccagcccgtagggggctacacggagactcagccacacatgactgtgaggccgccagggtcaatggggatgagtttgaacttagaaggagagtggcattatctatagacgctggactcaagagaagtaccccagcctccggaccaccaccaccaggctcacacctggttctggtccccgcttggccctctggcttcaggacccccacctcctccggccccctcactcaacgcctacctccctggggccccgccgggacatggggggcctgagcgccccctcgagggcctctcaaggacaaagacaaggcctccaggccctgcgccccacttctgccctcacctccgcccagaacccgagctgagatcctgggcccgagtcttcggaagatggtggctgggggtccccccgcctccaggacaaggaagggattggaggtgggctgggccatgagggacgggggttcacctggaccctacattttggagacgttcccttcatcccccagcccgcccccctcccctctccgcctacctcccttctctgatgtcttctactttgtttttaacgataaagtctt
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]