2025-08-29 11:06:44, GGRNA.v2 : RefSeq release 231 (Jul, 2025)
LOCUS XM_070498739 2426 bp mRNA linear MAM 18-DEC-2024 DEFINITION PREDICTED: Equus asinus Meis homeobox 3 (MEIS3), transcript variant X1, mRNA. ACCESSION XM_070498739 VERSION XM_070498739.1 DBLINK BioProject: PRJNA1198117 KEYWORDS RefSeq. SOURCE Equus asinus (donkey) ORGANISM Equus asinus Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Perissodactyla; Equidae; Equus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091815) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_041296235.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/16/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..2426 /organism="Equus asinus" /mol_type="mRNA" /isolate="D_3611" /db_xref="taxon:9793" /chromosome="26" /sex="male" /tissue_type="Whole blood in anticoagulant" /geo_loc_name="USA: Ithaca, New York" /collection_date="2018-03-01" /breed="Donkey" gene 1..2426 /gene="MEIS3" /note="Meis homeobox 3; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 long SRA reads, 1 Protein" /db_xref="GeneID:106845156" CDS 153..1358 /gene="MEIS3" /codon_start=1 /product="homeobox protein Meis3 isoform X1" /protein_id="XP_070354840.1" /db_xref="GeneID:106845156" /translation="
MARRYDELPHYPGIVDGTAALAGFSEAVPTAPRAPGPYGPHRPPQPPPLGLDSDGLKREKDEIYGHPLFPLLALVFEKCELATCSPRDVAGAGLGTPPGGDLCSSDSFNEDIAAFAKQVRSERPLFSSNPELDNLMIQAIQVLRFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIEDRDGGCREDLEDYPASCPSLPDQTNTWIRDHEDSGSVHLGTPGPSSGGLASQSGDNSSDQGDGLDTSVASPSSGGEDEELDQERRRNKKRGIFPKVATNIMRAWLFQHLSMTGQALGIGWRPGRQGDSRWWSQHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGAAFSPEGQPVGGYTETQPHMTVRPPGSMGMSLNLEGEWHYL"
misc_feature 447..701 /gene="MEIS3" /note="N-terminal of Homeobox Meis and PKNOX1; Region: Meis_PKNOX_N; pfam16493" /db_xref="CDD:465140" misc_feature 1089..1187 /gene="MEIS3" /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920" /db_xref="CDD:428673" ORIGIN
cggccgtgggggggtgggggagccgggcacccagcctcctgccccaccccctggcgtcggccccatcggccacccgggccgctgcccctggctgcgccctccccgccggccaggccctggagggacccgggagcggccgccggcttcagcccatggcccggaggtacgatgagctgcctcactacccaggcatcgtggatggcactgcagccctggctggcttctcggaggcagtgcccacagcaccgagagccccggggccctacggcccccaccggcctcctcagccccctcccctgggcttggacagcgatggcctgaagagagagaaggacgagatctacggacacccgctcttccccctgctggccctggtctttgagaaatgtgaactggccacgtgctcacctcgtgacgtggccggggctgggctgggcacgcccccgggcggcgacctctgctcctccgactccttcaatgaggacattgccgcttttgccaagcaggtccgctccgagaggcccctcttctcctccaacccggagctggacaatctgatgatccaggccatccaggtgctccggttccacctgctggagctggagaaggtccacgacctgtgcgacaacttctgtcatcgctacatcacctgcctcaagggaaagatgcccatcgacctggtcatcgaggatcgggacggcggctgcagggaggacctcgaggactacccggcctcctgccccagcctcccggatcagactaacacatggattagagaccatgaggacagtgggtctgtacatttggggaccccgggtccatccagtggtggcctggcctcccagagtggggacaactctagtgaccaaggagacggactggacacaagcgtggcctctcccagttctgggggagaggacgaggagctggaccaggagcggcgtcggaacaagaagcggggcatcttccccaaggtggccaccaacatcatgagagcctggctgttccagcacctctcgatgacaggccaggccttggggatcggatggcggcccggcaggcagggtgactctcgctggtggtcacagcacccgtacccctcggaggagcagaagaaacagctggcgcaggacacggggctcacgattctgcaagtcaacaactggttcattaacgcccggagacgcatcgtgcaacccatgatcgatcaatccaaccgcacagggcagggtgcagccttcagcccagagggccagcccgtagggggctacacggagactcagccacacatgactgtgaggccgccagggtcaatggggatgagtttgaacttagaaggagagtggcattatctatagacgctggactcaagagaagtacgtcacacccggggagagcacccacaggacgtggcagaggccgacacacacgctcaagcaggcggcgttgccagcgacccagcaaagttccagaaagggtcacccggagctaccctcggaaacactcgtgtgcggcccacagatggacaggccggacagcagggaggtcacgacccagactccagcccgaccggcctgggttcaagtccccgctctgccactcaccacgaggccttggtccccggacgaggtggccgtcatcaaacatccctccaggaccgtcagctgctgctgcctccagggtccgcccgccctgctcgttgttcccagactccaccgagctccgtgcgattctcgaggcttaggctccgaccttggtggagactgcccgggccggccccctccggggcctctgtcctggctgctccccctgcctgggacacccttcctggctcagaggtcgcgtctgcaaagaccagcagcagccaaaccaaggcagcccccttgtgaccctcacttgtggccccgacgccgcctccctgggattcgcgcggttacctgttcgccccgcccccttgtcactcattcattcaggcggctgcattccctgggcccgccctctctgcgggtccctgcacgtcgcaatcaagacctctgcccacggggactgacgtccacagtggaccccatcacctgagcgctcctgtagcctgcaagaagatgacgcgggtcataaaaaagtagagccgggtcgggcgggggtgggcctgccacccttccacctgcgtccccttcctctgcggcgtgctctgtgccaggccccgttctaggagcttgacacccaccgaccgggtcaaccccaccgctgagcctcagacggggggaccatcacgctccccacttcccggaggaggaaaccaaggcccagagaggcagatcgctcgcccggggtcacacagctgccgcgcgtgggtctcagaagcttgcgcgctagacagtcctcctgtcatttttaaaaaatataattcgaaggtgctatgattttta
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]