2025-07-03 09:13:13, GGRNA.v2 : RefSeq release 229 (Mar, 2025)
LOCUS XM_067541586 766 bp mRNA linear VRT 23-AUG-2024 DEFINITION PREDICTED: Emydura macquarii macquarii integrin alpha-D-like (LOC137148667), partial mRNA. ACCESSION XM_067541586 VERSION XM_067541586.1 DBLINK BioProject: PRJNA1122207 KEYWORDS RefSeq; includes ab initio. SOURCE Emydura macquarii macquarii ORGANISM Emydura macquarii macquarii Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archelosauria; Testudinata; Testudines; Pleurodira; Chelidae; Emydura. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_027130824) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_026122565.2-RS_2024_08 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 08/21/2024 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 23% of CDS bases ##RefSeq-Attributes-END## COMPLETENESS: incomplete on the 5' end. FEATURES Location/Qualifiers source 1..766 /organism="Emydura macquarii macquarii" /mol_type="mRNA" /isolate="MOO-44397" /sub_species="macquarii" /db_xref="taxon:1129001" /chromosome="Unknown" /sex="female" /tissue_type="ovaries" /dev_stage="adult" /ecotype="Brisbane River" /geo_loc_name="Australia: Queensland, Upper Brisbane River" gene <1..766 /gene="LOC137148667" /note="integrin alpha-D-like; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:137148667" CDS <1..525 /gene="LOC137148667" /codon_start=1 /product="integrin alpha-D-like" /protein_id="XP_067397687.1" /db_xref="GeneID:137148667" /translation="
PQLVQCVSEVATPVSKNFVKQMSEHPLLDCSIATCKKIWCTIASLELQQPLEFMIKGNISFQWVSQTQQQKVTLVSEAQIGYKEKKYTQQEGFIQRQVQTVVERYEVYNYLPIIMGSIMGGLVLLALIIAALYKVGFFTRQYKQRMEDAMEGEGAGPTQSATAGNAPASDAPKQ"
ORIGIN
ccccagctggttcagtgcgtcagtgaggtggcaacgcctgtttccaagaactttgtgaagcagatgagcgagcatcctctactggactgctccattgccacctgtaagaagatctggtgcacaatcgcctcccttgaattgcagcagccgctggagttcatgatcaaagggaacatcagcttccagtgggtttcccagactcagcagcagaaagtgactctggtgagcgaggcccagattggatacaaggaaaagaaatacacccagcaggagggattcatccagcgccaggtgcagacagtggtggagcgctatgaggtctataactacctgcccatcatcatgggaagcatcatggggggcctggtcctgctggctctcatcatcgcagctctctacaaggtcggcttcttcacacgccagtacaagcagaggatggaggacgctatggagggcgaaggggctggccccacccagagcgccaccgctggcaacgcccctgcctccgatgcccccaaacaatagccccccccccctttacacccctcccaccggtgttgcctcctcctgcgctgctcgagacccacccctgccccgttacatttgccacctccatgatgcagaaaaactggccaacttccccgtgaaaaaaggtgtcctattgccagctagagttaattgtttttcaaattaggcttagtagaattcaatttattttatttgttcttaattttgatggagaacgttggattatatttataggcat
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]