GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2025-07-03 09:22:14, GGRNA.v2 : RefSeq release 229 (Mar, 2025)

LOCUS       XM_065014390             403 bp    mRNA    linear   VRT 07-MAY-2024
DEFINITION  PREDICTED: Oncorhynchus nerka RNA binding protein fox-1 homolog
            1-like (LOC135566772), partial mRNA.
ACCESSION   XM_065014390
VERSION     XM_065014390.1
DBLINK      BioProject: PRJNA1106039
KEYWORDS    RefSeq.
SOURCE      Oncorhynchus nerka (sockeye salmon)
  ORGANISM  Oncorhynchus nerka
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Protacanthopterygii;
            Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_027037897) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_034236695.1-RS_2024_05
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.2
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 05/02/2024
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on the 3' end.
FEATURES             Location/Qualifiers
     source          1..403
                     /organism="Oncorhynchus nerka"
                     /mol_type="mRNA"
                     /isolate="Pitt River"
                     /db_xref="taxon:8023"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="multiple tissues"
                     /dev_stage="adult"
                     /geo_loc_name="Canada: Langley BC"
                     /collection_date="2020-06-06"
                     /collected_by="Lawrence J. Albright"
     gene            1..>403
                     /gene="LOC135566772"
                     /note="RNA binding protein fox-1 homolog 1-like; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon."
                     /db_xref="GeneID:135566772"
     CDS             122..>403
                     /gene="LOC135566772"
                     /codon_start=1
                     /product="RNA binding protein fox-1 homolog 1-like"
                     /protein_id="XP_064870462.1"
                     /db_xref="GeneID:135566772"
                     /translation="
MEEKEEGKMVEQGNQEAPPPPDSRTQPYPSAQFAPPQNGLPAEFSASHPHPAPPDYTGQPPVSEHPLNMYPTSQNHSEQSGQDTSIQTVSATAT"
ORIGIN      
cacacacggggaacagcgccccatccataattgatgctagctgtgggcaggcagatgctggaggcaggaggaagaagggaggaagaagggagggaaggagggagagcagctggatgtgtttatggaggagaaagaggaaggaaagatggtggagcagggtaaccaggaggcccctccccctccagactccaggactcagccgtacccctccgcccaatttgccccccctcagaacggcctgcccgctgagttcagcgcctcacaccctcaccctgcgccccccgactacacaggacagccccccgtcagcgaacaccccctaaacatgtaccccacttcacagaaccacagtgaacagagtggacaggacaccagcatacagaccgtctcagccacagccaca
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]