2024-09-08 08:42:02, GGRNA.v2 : RefSeq release 225 (Jul, 2024)
LOCUS XM_064994330 303 bp mRNA linear PLN 03-MAY-2024 DEFINITION Saccharomycopsis crataegensis ribosomal 60S subunit protein L36A (DASC09_007270), partial mRNA. ACCESSION XM_064994330 VERSION XM_064994330.1 DBLINK BioProject: PRJNA1107242 BioSample: SAMD00197834 Sequence Read Archive: DRR212821, DRR212827 KEYWORDS RefSeq. SOURCE Saccharomycopsis crataegensis ORGANISM Saccharomycopsis crataegensis Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycopsidaceae; Saccharomycopsis. REFERENCE 1 AUTHORS Mure,A., Sugiura,Y., Maeda,R., Honda,K., Sakurai,N., Takahashi,Y., Watada,M., Katoh,T., Gotoh,A., Gotoh,Y., Taniguchi,I., Nakamura,K., Hayashi,T., Katayama,T., Uemura,T. and Hattori,Y. TITLE Identification of key yeast species and microbe-microbe interactions impacting larval growth of Drosophila in the wild JOURNAL Elife 12, 90148 (2023) PUBMED 38150375 REMARK DOI:10.7554/eLife.90148 Publication Status: Online-Only REFERENCE 2 (bases 1 to 303) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (03-MAY-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 303) AUTHORS Mure,A. and Hattori,Y. TITLE Direct Submission JOURNAL Submitted (27-JUN-2023) Contact:Yukako Hattori Kyoto University; Yoshida Konoe-cho, Sakyo-ku, Kyoto, Kyoto 606-8501, Japan:Osaka COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_027043819). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..303 /organism="Saccharomycopsis crataegensis" /mol_type="mRNA" /strain="SC-9" /host="Drosophila melanogaster" /db_xref="taxon:43959" /chromosome="Unknown" /geo_loc_name="Japan:Osaka" /collection_date="2017-11-02" gene <1..>303 /locus_tag="DASC09_007270" /db_xref="GeneID:90071381" CDS 1..303 /locus_tag="DASC09_007270" /note="ID:gene_00727; source:AUGUSTUS" /codon_start=1 /transl_table=12 /product="ribosomal 60S subunit protein L36A" /protein_id="XP_064850402.1" /db_xref="GeneID:90071381" /translation="
MAKSGIAVGLNKGHVVTSKAVAPKISYRKGALSKRTSFVRDIVREVGGLAPYERRLIELLRNSGEKRAKKLAKKRLGTLKRAKAKLEEINKIMAEQRRHH"
ORIGIN
atggctaaatctggtattgctgttggtttgaacaaaggtcacgtcgtcacctccaaggctgttgccccaaagatttcctacagaaagggtgctctctccaagagaacttcttttgtcagagatattgtcagagaagtcggtggtttggctccatacgaaagaagattgattgaattgttgagaaactctggtgaaaagagagctaagaagttggccaagaagagattgggtactttgaagagagctaaggccaagttggaagaaatcaacaagatcatggctgaacaaagaagacaccactaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]