2024-10-18 12:04:48, GGRNA.v2 : RefSeq release 225 (Jul, 2024)
LOCUS XM_064871506 243 bp mRNA linear PLN 01-MAY-2024 DEFINITION Knufia obscura uncharacterized protein (PMZ80_003077), partial mRNA. ACCESSION XM_064871506 VERSION XM_064871506.1 DBLINK BioProject: PRJNA1105961 BioSample: SAMN32875987 KEYWORDS RefSeq. SOURCE Knufia obscura ORGANISM Knufia obscura Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina; Eurotiomycetes; Chaetothyriomycetidae; Chaetothyriales; Trichomeriaceae; Knufia. REFERENCE 1 (bases 1 to 243) AUTHORS Chander,A.M., Teixeira,M.M., Singh,N.K., Williams,M.P., Parker,C.W., Leo,P., Stajich,J.E., Torok,T., Tighe,S., Mason,C.E. and Venkateswaran,K. TITLE Genomic and morphological characterization of Knufia obscura isolated from the Mars 2020 spacecraft assembly facility JOURNAL Res Sq (2023) In press REMARK DOI: 10.21203/rs.3.rs-3376475/v1 REFERENCE 2 (bases 1 to 243) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (30-APR-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 243) AUTHORS Teixeira,M., Chander,A.M., Stajich,J.E. and Venkateswaran,K. TITLE Direct Submission JOURNAL Submitted (30-JAN-2023) Faculty of Medicine, University of Brasilia, Campus Universitario Darcy Ribeiro, Faculdade de Medicina, Asa Norte, Brasilia, DF 70910900, Brazil COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_027042689). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..243 /organism="Knufia obscura" /mol_type="mRNA" /strain="CCFEE 5817" /isolate="CBS 148926" /isolation_source="Gasoline car tank" /type_material="holotype of Knufia obscura" /db_xref="taxon:1635080" /chromosome="Unknown" /geo_loc_name="Italy" /collection_date="2019" /collected_by="Fabiana Canini" gene <1..>243 /locus_tag="PMZ80_003077" /db_xref="GeneID:89996526" CDS 1..243 /locus_tag="PMZ80_003077" /note="EggNog:ENOG503P72A; COG:S" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_064731886.1" /db_xref="GeneID:89996526" /translation="
MATGEDALAGQEEIGITHRFPPDPANSRRICFKGLYLSIYNQKTKDRKTFEENVSEYKEFEVPAGYTCYVRVATVYFVQN"
ORIGIN
atggcgacaggggaagacgccctcgcaggacaagaagagattggaataacgcatcggttccctccagaccccgctaacagtcggagaatctgctttaaaggtttatacctttcaatctacaaccagaagacgaaagaccgaaagaccttcgaagaaaatgtatctgaatacaaagaatttgaggtaccagccggatacacttgctatgtcagagttgctacggtgtattttgtacaaaattaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]